Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3911439..3912057 | Replicon | chromosome |
| Accession | NZ_LR134092 | ||
| Organism | Escherichia coli strain NCTC10444 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | EL041_RS19085 | Protein ID | WP_001291435.1 |
| Coordinates | 3911839..3912057 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | EL041_RS19080 | Protein ID | WP_000344800.1 |
| Coordinates | 3911439..3911813 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL041_RS19070 | 3906528..3907721 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| EL041_RS19075 | 3907744..3910893 | + | 3150 | WP_001132469.1 | multidrug efflux RND transporter permease subunit | - |
| EL041_RS19080 | 3911439..3911813 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| EL041_RS19085 | 3911839..3912057 | + | 219 | WP_001291435.1 | hemolysin expression modulator Hha | Toxin |
| EL041_RS19090 | 3912229..3912780 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| EL041_RS19095 | 3912896..3913366 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| EL041_RS19100 | 3913530..3915080 | + | 1551 | WP_001362407.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| EL041_RS19105 | 3915122..3915475 | - | 354 | WP_000878146.1 | DUF1428 family protein | - |
| EL041_RS19115 | 3915854..3916165 | + | 312 | WP_000409914.1 | MGMT family protein | - |
| EL041_RS19120 | 3916196..3916768 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T286773 WP_001291435.1 NZ_LR134092:3911839-3912057 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT286773 WP_000344800.1 NZ_LR134092:3911439-3911813 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |