Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 3313750..3314568 | Replicon | chromosome |
Accession | NZ_LR134092 | ||
Organism | Escherichia coli strain NCTC10444 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A0E0Y102 |
Locus tag | EL041_RS16190 | Protein ID | WP_000771609.1 |
Coordinates | 3313750..3314124 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A0E0Y470 |
Locus tag | EL041_RS16195 | Protein ID | WP_001285568.1 |
Coordinates | 3314215..3314568 (-) | Length | 118 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL041_RS16160 | 3310428..3311132 | + | 705 | WP_001241678.1 | leucyl/phenylalanyl-tRNA--protein transferase | - |
EL041_RS16165 | 3311417..3311635 | + | 219 | WP_001040187.1 | translation initiation factor IF-1 | - |
EL041_RS16175 | 3312126..3312968 | - | 843 | WP_001274560.1 | DUF4942 domain-containing protein | - |
EL041_RS16180 | 3313053..3313250 | - | 198 | WP_000839270.1 | DUF957 domain-containing protein | - |
EL041_RS16185 | 3313262..3313753 | - | 492 | WP_000976860.1 | hypothetical protein | - |
EL041_RS16190 | 3313750..3314124 | - | 375 | WP_000771609.1 | TA system toxin CbtA family protein | Toxin |
EL041_RS16195 | 3314215..3314568 | - | 354 | WP_001285568.1 | type IV toxin-antitoxin system toxin CbtA | Antitoxin |
EL041_RS16200 | 3314644..3314865 | - | 222 | WP_000692357.1 | DUF987 domain-containing protein | - |
EL041_RS16205 | 3314928..3315404 | - | 477 | WP_001186756.1 | RadC family protein | - |
EL041_RS16210 | 3315420..3315893 | - | 474 | WP_000855049.1 | antirestriction protein | - |
EL041_RS16215 | 3315987..3316232 | - | 246 | WP_001164966.1 | hypothetical protein | - |
EL041_RS16220 | 3316232..3317053 | - | 822 | WP_001241709.1 | DUF945 domain-containing protein | - |
EL041_RS16230 | 3317274..3317684 | - | 411 | WP_000846716.1 | hypothetical protein | - |
EL041_RS16235 | 3317700..3318383 | - | 684 | WP_000775510.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14006.09 Da Isoelectric Point: 7.2652
>T286772 WP_000771609.1 NZ_LR134092:c3314124-3313750 [Escherichia coli]
MKLLPDTHVREASCCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAK
MKLLPDTHVREASCCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAK
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0Y102 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0Y470 |