Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3088131..3088947 | Replicon | chromosome |
| Accession | NZ_LR134092 | ||
| Organism | Escherichia coli strain NCTC10444 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | EL041_RS15070 | Protein ID | WP_126297929.1 |
| Coordinates | 3088131..3088505 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | EL041_RS15075 | Protein ID | WP_164550094.1 |
| Coordinates | 3088594..3088947 (-) | Length | 118 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL041_RS15030 | 3083135..3083626 | - | 492 | WP_001300785.1 | DUF1097 domain-containing protein | - |
| EL041_RS15035 | 3083728..3084282 | - | 555 | WP_001001918.1 | molecular chaperone YcdY | - |
| EL041_RS15040 | 3084306..3085043 | - | 738 | WP_000283664.1 | zinc-binding phosphatase | - |
| EL041_RS15045 | 3085098..3086036 | - | 939 | WP_000351317.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
| EL041_RS15055 | 3086507..3087349 | - | 843 | WP_126297923.1 | DUF4942 domain-containing protein | - |
| EL041_RS15060 | 3087434..3087631 | - | 198 | WP_126297925.1 | DUF957 domain-containing protein | - |
| EL041_RS15065 | 3087643..3088134 | - | 492 | WP_126297927.1 | hypothetical protein | - |
| EL041_RS15070 | 3088131..3088505 | - | 375 | WP_126297929.1 | type IV toxin-antitoxin system toxin CbtA | Toxin |
| EL041_RS15075 | 3088594..3088947 | - | 354 | WP_164550094.1 | type IV toxin-antitoxin system toxin CbtA | Antitoxin |
| EL041_RS15080 | 3089021..3089242 | - | 222 | WP_126297933.1 | DUF987 domain-containing protein | - |
| EL041_RS15085 | 3089305..3089781 | - | 477 | WP_001186193.1 | RadC family protein | - |
| EL041_RS15090 | 3089797..3090270 | - | 474 | WP_001313575.1 | antirestriction protein | - |
| EL041_RS15095 | 3090533..3091351 | - | 819 | WP_126297935.1 | DUF945 domain-containing protein | - |
| EL041_RS15100 | 3091497..3091655 | - | 159 | Protein_2913 | transposase | - |
| EL041_RS15105 | 3091729..3093057 | + | 1329 | WP_000547316.1 | IS4-like element IS4 family transposase | - |
| EL041_RS15110 | 3093073..3093393 | - | 321 | Protein_2915 | IS200/IS605-like element IS200C family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13842.88 Da Isoelectric Point: 7.8839
>T286771 WP_126297929.1 NZ_LR134092:c3088505-3088131 [Escherichia coli]
MKTLPVLPGQAAGSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAK
MKTLPVLPGQAAGSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAK
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|