Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3088131..3088947 Replicon chromosome
Accession NZ_LR134092
Organism Escherichia coli strain NCTC10444

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag EL041_RS15070 Protein ID WP_126297929.1
Coordinates 3088131..3088505 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag EL041_RS15075 Protein ID WP_164550094.1
Coordinates 3088594..3088947 (-) Length 118 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL041_RS15030 3083135..3083626 - 492 WP_001300785.1 DUF1097 domain-containing protein -
EL041_RS15035 3083728..3084282 - 555 WP_001001918.1 molecular chaperone YcdY -
EL041_RS15040 3084306..3085043 - 738 WP_000283664.1 zinc-binding phosphatase -
EL041_RS15045 3085098..3086036 - 939 WP_000351317.1 glyoxylate/hydroxypyruvate reductase GhrA -
EL041_RS15055 3086507..3087349 - 843 WP_126297923.1 DUF4942 domain-containing protein -
EL041_RS15060 3087434..3087631 - 198 WP_126297925.1 DUF957 domain-containing protein -
EL041_RS15065 3087643..3088134 - 492 WP_126297927.1 hypothetical protein -
EL041_RS15070 3088131..3088505 - 375 WP_126297929.1 type IV toxin-antitoxin system toxin CbtA Toxin
EL041_RS15075 3088594..3088947 - 354 WP_164550094.1 type IV toxin-antitoxin system toxin CbtA Antitoxin
EL041_RS15080 3089021..3089242 - 222 WP_126297933.1 DUF987 domain-containing protein -
EL041_RS15085 3089305..3089781 - 477 WP_001186193.1 RadC family protein -
EL041_RS15090 3089797..3090270 - 474 WP_001313575.1 antirestriction protein -
EL041_RS15095 3090533..3091351 - 819 WP_126297935.1 DUF945 domain-containing protein -
EL041_RS15100 3091497..3091655 - 159 Protein_2913 transposase -
EL041_RS15105 3091729..3093057 + 1329 WP_000547316.1 IS4-like element IS4 family transposase -
EL041_RS15110 3093073..3093393 - 321 Protein_2915 IS200/IS605-like element IS200C family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(13-112)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13842.88 Da        Isoelectric Point: 7.8839

>T286771 WP_126297929.1 NZ_LR134092:c3088505-3088131 [Escherichia coli]
MKTLPVLPGQAAGSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 118 a.a.        Molecular weight: 13051.75 Da        Isoelectric Point: 5.0469

>AT286771 WP_164550094.1 NZ_LR134092:c3088947-3088594 [Escherichia coli]
VSDTLPDDNQDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGQFSDADANHLDQAFPLLMKQLELMLTSGELNPR
HQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN

Download         Length: 354 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References