Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2656820..2657458 | Replicon | chromosome |
| Accession | NZ_LR134092 | ||
| Organism | Escherichia coli strain NCTC10444 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A080J2T0 |
| Locus tag | EL041_RS12875 | Protein ID | WP_000813793.1 |
| Coordinates | 2657282..2657458 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | EL041_RS12870 | Protein ID | WP_001270286.1 |
| Coordinates | 2656820..2657236 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL041_RS12850 | 2651972..2652913 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
| EL041_RS12855 | 2652914..2653927 | - | 1014 | WP_000220411.1 | ABC transporter ATP-binding protein | - |
| EL041_RS12860 | 2653945..2655090 | - | 1146 | WP_000047419.1 | ABC transporter substrate-binding protein | - |
| EL041_RS12865 | 2655335..2656741 | - | 1407 | WP_000760655.1 | PLP-dependent aminotransferase family protein | - |
| EL041_RS12870 | 2656820..2657236 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| EL041_RS12875 | 2657282..2657458 | - | 177 | WP_000813793.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| EL041_RS12880 | 2657680..2657910 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| EL041_RS12885 | 2658002..2659963 | - | 1962 | WP_024257894.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| EL041_RS12890 | 2660036..2660572 | - | 537 | WP_000429150.1 | DNA-binding transcriptional regulator SutR | - |
| EL041_RS12895 | 2660625..2661836 | + | 1212 | WP_023154256.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6724.83 Da Isoelectric Point: 10.9223
>T286770 WP_000813793.1 NZ_LR134092:c2657458-2657282 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGMRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGMRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT286770 WP_001270286.1 NZ_LR134092:c2657236-2656820 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|