Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 1133166..1133749 | Replicon | chromosome |
| Accession | NZ_LR134092 | ||
| Organism | Escherichia coli strain NCTC10444 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | U9Y5H3 |
| Locus tag | EL041_RS05515 | Protein ID | WP_000254735.1 |
| Coordinates | 1133414..1133749 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | U9Y5F1 |
| Locus tag | EL041_RS05510 | Protein ID | WP_000581936.1 |
| Coordinates | 1133166..1133414 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL041_RS05500 | 1129505..1130806 | + | 1302 | WP_000046797.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
| EL041_RS05505 | 1130854..1133088 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
| EL041_RS05510 | 1133166..1133414 | + | 249 | WP_000581936.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| EL041_RS05515 | 1133414..1133749 | + | 336 | WP_000254735.1 | endoribonuclease MazF | Toxin |
| EL041_RS05520 | 1133821..1134612 | + | 792 | WP_001071673.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| EL041_RS05525 | 1134840..1136477 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
| EL041_RS05530 | 1136565..1137863 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12070.03 Da Isoelectric Point: 8.2605
>T286761 WP_000254735.1 NZ_LR134092:1133414-1133749 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRAKGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRAKGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|