Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 50817..51649 | Replicon | chromosome |
Accession | NZ_LR134092 | ||
Organism | Escherichia coli strain NCTC10444 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | S1PD64 |
Locus tag | EL041_RS00255 | Protein ID | WP_000854753.1 |
Coordinates | 50817..51191 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | Q5I3J0 |
Locus tag | EL041_RS00260 | Protein ID | WP_001280951.1 |
Coordinates | 51281..51649 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL041_RS00225 | 46183..47106 | - | 924 | WP_000535963.1 | carboxylate/amino acid/amine transporter | - |
EL041_RS00230 | 47217..48401 | - | 1185 | WP_001172876.1 | sugar efflux transporter | - |
EL041_RS00240 | 49193..50038 | - | 846 | WP_001406222.1 | DUF4942 domain-containing protein | - |
EL041_RS00245 | 50123..50320 | - | 198 | WP_000839243.1 | DUF957 domain-containing protein | - |
EL041_RS00250 | 50332..50820 | - | 489 | WP_001549830.1 | hypothetical protein | - |
EL041_RS00255 | 50817..51191 | - | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
EL041_RS00260 | 51281..51649 | - | 369 | WP_001280951.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
EL041_RS00265 | 51812..52033 | - | 222 | WP_001405861.1 | DUF987 domain-containing protein | - |
EL041_RS00270 | 52102..52578 | - | 477 | WP_001186724.1 | RadC family protein | - |
EL041_RS00275 | 52594..53079 | - | 486 | WP_001469549.1 | antirestriction protein | - |
EL041_RS00280 | 53134..53952 | - | 819 | WP_001234620.1 | DUF945 domain-containing protein | - |
EL041_RS00290 | 54052..54285 | - | 234 | WP_001119729.1 | DUF905 family protein | - |
EL041_RS00295 | 54364..54819 | - | 456 | WP_000581504.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T286755 WP_000854753.1 NZ_LR134092:c51191-50817 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LVU0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q5I3J0 |