Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2079533..2080062 | Replicon | chromosome |
| Accession | NZ_LR134091 | ||
| Organism | Staphylococcus aureus strain NCTC4137 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | ELZ58_RS10745 | Protein ID | WP_000621175.1 |
| Coordinates | 2079533..2079895 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | ELZ58_RS10750 | Protein ID | WP_000948331.1 |
| Coordinates | 2079892..2080062 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ELZ58_RS10720 | 2076511..2077281 | - | 771 | WP_001041102.1 | RNA polymerase sigma factor SigB | - |
| ELZ58_RS10725 | 2077256..2077735 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
| ELZ58_RS10730 | 2077737..2078063 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| ELZ58_RS10735 | 2078182..2079183 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| ELZ58_RS10745 | 2079533..2079895 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| ELZ58_RS10750 | 2079892..2080062 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| ELZ58_RS10755 | 2080147..2081295 | - | 1149 | WP_001281154.1 | alanine racemase | - |
| ELZ58_RS10760 | 2081361..2081720 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
| ELZ58_RS10765 | 2081724..2082215 | - | 492 | WP_001205912.1 | PH domain-containing protein | - |
| ELZ58_RS10770 | 2082202..2083785 | - | 1584 | WP_126508764.1 | PH domain-containing protein | - |
| ELZ58_RS10775 | 2083778..2084257 | - | 480 | WP_001287079.1 | hypothetical protein | - |
| ELZ58_RS10780 | 2084466..2085026 | - | 561 | WP_001092409.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T286750 WP_000621175.1 NZ_LR134091:c2079895-2079533 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|