Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1877034..1877810 | Replicon | chromosome |
Accession | NZ_LR134091 | ||
Organism | Staphylococcus aureus strain NCTC4137 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | X5E2E6 |
Locus tag | ELZ58_RS09420 | Protein ID | WP_000031108.1 |
Coordinates | 1877034..1877186 (-) | Length | 51 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | W8U4V4 |
Locus tag | ELZ58_RS09425 | Protein ID | WP_001251224.1 |
Coordinates | 1877211..1877810 (-) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ELZ58_RS09400 | 1873241..1874062 | + | 822 | WP_000669376.1 | RluA family pseudouridine synthase | - |
ELZ58_RS09405 | 1874514..1875899 | - | 1386 | WP_000116229.1 | class II fumarate hydratase | - |
ELZ58_RS09410 | 1876095..1876490 | - | 396 | WP_000901023.1 | hypothetical protein | - |
ELZ58_RS09420 | 1877034..1877186 | - | 153 | WP_000031108.1 | hypothetical protein | Toxin |
ELZ58_RS09425 | 1877211..1877810 | - | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
ELZ58_RS09430 | 1877969..1878439 | - | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
ELZ58_RS09435 | 1878444..1879571 | - | 1128 | WP_126508759.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
ELZ58_RS09440 | 1879723..1880445 | - | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
ELZ58_RS09445 | 1880438..1881895 | - | 1458 | WP_000649907.1 | ABC transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1882194..1883513 | 1319 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T286746 WP_000031108.1 NZ_LR134091:c1877186-1877034 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT286746 WP_001251224.1 NZ_LR134091:c1877810-1877211 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|