Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2168124..2168653 | Replicon | chromosome |
| Accession | NZ_LR134090 | ||
| Organism | Staphylococcus aureus strain NCTC9555 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | ELZ60_RS11360 | Protein ID | WP_000621175.1 |
| Coordinates | 2168124..2168486 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | ELZ60_RS11365 | Protein ID | WP_000948331.1 |
| Coordinates | 2168483..2168653 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ELZ60_RS11335 | 2165102..2165872 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
| ELZ60_RS11340 | 2165847..2166326 | - | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
| ELZ60_RS11345 | 2166328..2166654 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| ELZ60_RS11350 | 2166773..2167774 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| ELZ60_RS11360 | 2168124..2168486 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| ELZ60_RS11365 | 2168483..2168653 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| ELZ60_RS11370 | 2168738..2169886 | - | 1149 | WP_001281150.1 | alanine racemase | - |
| ELZ60_RS11375 | 2169952..2170311 | - | 360 | WP_000581198.1 | holo-ACP synthase | - |
| ELZ60_RS11380 | 2170315..2170806 | - | 492 | WP_001286982.1 | PH domain-containing protein | - |
| ELZ60_RS11385 | 2170799..2172376 | - | 1578 | WP_126509085.1 | PH domain-containing protein | - |
| ELZ60_RS11390 | 2172369..2172848 | - | 480 | WP_001287084.1 | hypothetical protein | - |
| ELZ60_RS11395 | 2173057..2173617 | - | 561 | WP_001092415.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T286739 WP_000621175.1 NZ_LR134090:c2168486-2168124 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|