Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 870334..870811 Replicon chromosome
Accession NZ_LR134090
Organism Staphylococcus aureus strain NCTC9555

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag ELZ60_RS04415 Protein ID WP_000052076.1
Coordinates 870334..870522 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag ELZ60_RS04420 Protein ID WP_001059690.1
Coordinates 870551..870811 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ELZ60_RS04385 866321..866842 + 522 WP_000824478.1 hypothetical protein -
ELZ60_RS04390 867183..867869 + 687 WP_001641381.1 thermonuclease family protein -
ELZ60_RS04395 868226..868426 + 201 WP_001059082.1 cold-shock protein -
ELZ60_RS04400 868925..869143 - 219 WP_000005880.1 hypothetical protein -
ELZ60_RS04405 869205..869489 - 285 WP_001004402.1 hypothetical protein -
ELZ60_RS04410 869577..870146 - 570 WP_001106650.1 hypothetical protein -
ELZ60_RS04415 870334..870522 - 189 WP_000052076.1 hypothetical protein Toxin
ELZ60_RS04420 870551..870811 - 261 WP_001059690.1 hypothetical protein Antitoxin
ELZ60_RS04425 871152..871355 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
ELZ60_RS04430 871352..871588 - 237 WP_000368687.1 hypothetical protein -
ELZ60_RS04435 871813..872394 + 582 WP_001140696.1 phosphoglycerate mutase family protein -
ELZ60_RS04440 872467..873084 - 618 WP_000255553.1 LysE/ArgO family amino acid transporter -
ELZ60_RS04445 873240..873734 - 495 WP_000569881.1 GNAT family N-acetyltransferase -
ELZ60_RS04450 874133..874555 - 423 WP_000974462.1 organic hydroperoxide resistance protein -
ELZ60_RS04455 874703..875419 + 717 WP_126509028.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T286736 WP_000052076.1 NZ_LR134090:c870522-870334 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT286736 WP_001059690.1 NZ_LR134090:c870811-870551 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References