Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 867818..868347 | Replicon | chromosome |
| Accession | NZ_LR134089 | ||
| Organism | Staphylococcus saprophyticus strain NCTC7666 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | ELZ48_RS04150 | Protein ID | WP_002482752.1 |
| Coordinates | 867985..868347 (+) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A380HJK7 |
| Locus tag | ELZ48_RS04145 | Protein ID | WP_037538046.1 |
| Coordinates | 867818..867988 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ELZ48_RS04120 | 863549..864028 | + | 480 | WP_002482747.1 | PH domain-containing protein | - |
| ELZ48_RS04125 | 864021..865559 | + | 1539 | WP_115338429.1 | PH domain-containing protein | - |
| ELZ48_RS04130 | 865552..866052 | + | 501 | WP_002482749.1 | PH domain-containing protein | - |
| ELZ48_RS04135 | 866116..866466 | + | 351 | WP_002482750.1 | holo-ACP synthase | - |
| ELZ48_RS04140 | 866582..867730 | + | 1149 | WP_002482751.1 | alanine racemase | - |
| ELZ48_RS04145 | 867818..867988 | + | 171 | WP_037538046.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| ELZ48_RS04150 | 867985..868347 | + | 363 | WP_002482752.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| ELZ48_RS04155 | 868684..869685 | + | 1002 | WP_041080774.1 | PP2C family protein-serine/threonine phosphatase | - |
| ELZ48_RS04160 | 869764..870090 | + | 327 | WP_011302705.1 | anti-sigma factor antagonist | - |
| ELZ48_RS04165 | 870092..870574 | + | 483 | WP_115338431.1 | anti-sigma B factor RsbW | - |
| ELZ48_RS04170 | 870549..871308 | + | 760 | Protein_822 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13498.70 Da Isoelectric Point: 10.3173
>T286729 WP_002482752.1 NZ_LR134089:867985-868347 [Staphylococcus saprophyticus]
MMRRGDVYLADLSPVQGSEQGGIRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKSKYKLDKDSVILLEQIR
TLDKNRLKEKLTYLSDKKMKEVNNAIDISLGLHTIRSHKS
MMRRGDVYLADLSPVQGSEQGGIRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKSKYKLDKDSVILLEQIR
TLDKNRLKEKLTYLSDKKMKEVNNAIDISLGLHTIRSHKS
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|