Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2162120..2162649 | Replicon | chromosome |
| Accession | NZ_LR134086 | ||
| Organism | Staphylococcus aureus strain NCTC13142 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | ELZ49_RS11130 | Protein ID | WP_000621175.1 |
| Coordinates | 2162120..2162482 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | ELZ49_RS11135 | Protein ID | WP_000948330.1 |
| Coordinates | 2162479..2162649 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ELZ49_RS11105 | 2159098..2159868 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
| ELZ49_RS11110 | 2159843..2160322 | - | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
| ELZ49_RS11115 | 2160324..2160650 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| ELZ49_RS11120 | 2160770..2161771 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| ELZ49_RS11130 | 2162120..2162482 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| ELZ49_RS11135 | 2162479..2162649 | - | 171 | WP_000948330.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| ELZ49_RS11140 | 2162734..2163882 | - | 1149 | WP_001281141.1 | alanine racemase | - |
| ELZ49_RS11145 | 2163948..2164307 | - | 360 | WP_000581193.1 | holo-ACP synthase | - |
| ELZ49_RS11150 | 2164311..2164802 | - | 492 | WP_001205918.1 | PH domain-containing protein | - |
| ELZ49_RS11155 | 2164789..2166372 | - | 1584 | WP_001294624.1 | PH domain-containing protein | - |
| ELZ49_RS11160 | 2166365..2166844 | - | 480 | WP_001287080.1 | hypothetical protein | - |
| ELZ49_RS11165 | 2167053..2167613 | - | 561 | WP_001092400.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T286711 WP_000621175.1 NZ_LR134086:c2162482-2162120 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|