Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 846867..847344 Replicon chromosome
Accession NZ_LR134086
Organism Staphylococcus aureus strain NCTC13142

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag ELZ49_RS04110 Protein ID WP_000052076.1
Coordinates 846867..847055 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag ELZ49_RS04115 Protein ID WP_001059690.1
Coordinates 847084..847344 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ELZ49_RS04080 842857..843378 + 522 WP_000824488.1 hypothetical protein -
ELZ49_RS04085 843719..844405 + 687 WP_001670297.1 thermonuclease family protein -
ELZ49_RS04090 844762..844962 + 201 WP_001059082.1 cold-shock protein -
ELZ49_RS04095 845458..845676 - 219 WP_000005876.1 hypothetical protein -
ELZ49_RS04100 845738..846022 - 285 WP_001004395.1 hypothetical protein -
ELZ49_RS04105 846110..846679 - 570 WP_001106646.1 hypothetical protein -
ELZ49_RS04110 846867..847055 - 189 WP_000052076.1 hypothetical protein Toxin
ELZ49_RS04115 847084..847344 - 261 WP_001059690.1 hypothetical protein Antitoxin
ELZ49_RS04120 847684..847887 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
ELZ49_RS04125 847884..848120 - 237 WP_000368687.1 hypothetical protein -
ELZ49_RS04130 848345..848926 + 582 WP_001140696.1 phosphoglycerate mutase family protein -
ELZ49_RS04135 848999..849616 - 618 WP_000255559.1 LysE/ArgO family amino acid transporter -
ELZ49_RS04140 849770..850264 - 495 WP_000590539.1 GNAT family N-acetyltransferase -
ELZ49_RS04145 850663..851085 - 423 WP_000974455.1 organic hydroperoxide resistance protein -
ELZ49_RS04150 851233..851949 + 717 WP_000150015.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T286701 WP_000052076.1 NZ_LR134086:c847055-846867 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT286701 WP_001059690.1 NZ_LR134086:c847344-847084 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References