Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 896324..896801 Replicon chromosome
Accession NZ_LR134085
Organism Staphylococcus aureus strain NCTC12233

Toxin (Protein)


Gene name TsaT Uniprot ID Q2G005
Locus tag ELZ52_RS04620 Protein ID WP_000052078.1
Coordinates 896324..896512 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag ELZ52_RS04625 Protein ID WP_001059690.1
Coordinates 896541..896801 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ELZ52_RS04590 892365..892835 + 471 WP_000824472.1 hypothetical protein -
ELZ52_RS04595 893176..893862 + 687 WP_001548082.1 thermonuclease family protein -
ELZ52_RS04600 894219..894419 + 201 WP_001059082.1 cold-shock protein -
ELZ52_RS04605 894915..895133 - 219 WP_000005886.1 hypothetical protein -
ELZ52_RS04610 895195..895479 - 285 WP_001004395.1 hypothetical protein -
ELZ52_RS04615 895567..896136 - 570 WP_001106654.1 hypothetical protein -
ELZ52_RS04620 896324..896512 - 189 WP_000052078.1 hypothetical protein Toxin
ELZ52_RS04625 896541..896801 - 261 WP_001059690.1 hypothetical protein Antitoxin
ELZ52_RS04630 897142..897345 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
ELZ52_RS04635 897342..897578 - 237 WP_000368687.1 hypothetical protein -
ELZ52_RS04640 897803..898384 + 582 WP_001140686.1 phosphoglycerate mutase family protein -
ELZ52_RS04645 898457..899074 - 618 WP_000255561.1 LysE/ArgO family amino acid transporter -
ELZ52_RS04650 899229..899723 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
ELZ52_RS04655 900122..900544 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
ELZ52_RS04660 900692..901408 + 717 WP_000150017.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - vWbp 865007..899723 34716


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7172.84 Da        Isoelectric Point: 9.9971

>T286688 WP_000052078.1 NZ_LR134085:c896512-896324 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTSKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT286688 WP_001059690.1 NZ_LR134085:c896801-896541 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D6HZ40

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References