Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4047771..4048603 | Replicon | chromosome |
| Accession | NZ_LR134082 | ||
| Organism | Escherichia coli strain NCTC9038 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PD64 |
| Locus tag | EL018_RS19670 | Protein ID | WP_000854753.1 |
| Coordinates | 4047771..4048145 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | V0ULY5 |
| Locus tag | EL018_RS19675 | Protein ID | WP_001315620.1 |
| Coordinates | 4048235..4048603 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL018_RS19625 | 4042986..4044092 | + | 1107 | WP_001341302.1 | N-acetylneuraminate epimerase | - |
| EL018_RS19630 | 4044157..4045137 | + | 981 | WP_000991415.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
| EL018_RS19635 | 4045145..4045795 | - | 651 | WP_001037966.1 | HNH endonuclease | - |
| EL018_RS22790 | 4046840..4046992 | - | 153 | WP_001280445.1 | hypothetical protein | - |
| EL018_RS19660 | 4047077..4047274 | - | 198 | WP_000839281.1 | DUF957 domain-containing protein | - |
| EL018_RS19665 | 4047286..4047774 | - | 489 | WP_000777547.1 | hypothetical protein | - |
| EL018_RS19670 | 4047771..4048145 | - | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
| EL018_RS19675 | 4048235..4048603 | - | 369 | WP_001315620.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| EL018_RS19680 | 4048766..4048987 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| EL018_RS19685 | 4049050..4049526 | - | 477 | WP_001186774.1 | RadC family protein | - |
| EL018_RS19690 | 4049542..4049745 | - | 204 | Protein_3817 | antirestriction protein | - |
| EL018_RS19695 | 4049767..4049832 | + | 66 | Protein_3818 | omptin family outer membrane protease | - |
| EL018_RS19700 | 4049852..4050548 | - | 697 | Protein_3819 | IS1 family transposase | - |
| EL018_RS23035 | 4050635..4050703 | - | 69 | WP_211180522.1 | protein YkiE | - |
| EL018_RS19705 | 4050840..4051361 | + | 522 | WP_001283626.1 | RNA polymerase sigma factor FecI | - |
| EL018_RS19710 | 4051358..4052311 | + | 954 | WP_001068910.1 | fec operon regulator FecR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 4050061..4050354 | 293 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T286684 WP_000854753.1 NZ_LR134082:c4048145-4047771 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13474.20 Da Isoelectric Point: 6.2050
>AT286684 WP_001315620.1 NZ_LR134082:c4048603-4048235 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LVU0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0ULY5 |