Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4047771..4048603 Replicon chromosome
Accession NZ_LR134082
Organism Escherichia coli strain NCTC9038

Toxin (Protein)


Gene name yeeV Uniprot ID S1PD64
Locus tag EL018_RS19670 Protein ID WP_000854753.1
Coordinates 4047771..4048145 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID V0ULY5
Locus tag EL018_RS19675 Protein ID WP_001315620.1
Coordinates 4048235..4048603 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL018_RS19625 4042986..4044092 + 1107 WP_001341302.1 N-acetylneuraminate epimerase -
EL018_RS19630 4044157..4045137 + 981 WP_000991415.1 9-O-acetyl-N-acetylneuraminic acid deacetylase -
EL018_RS19635 4045145..4045795 - 651 WP_001037966.1 HNH endonuclease -
EL018_RS22790 4046840..4046992 - 153 WP_001280445.1 hypothetical protein -
EL018_RS19660 4047077..4047274 - 198 WP_000839281.1 DUF957 domain-containing protein -
EL018_RS19665 4047286..4047774 - 489 WP_000777547.1 hypothetical protein -
EL018_RS19670 4047771..4048145 - 375 WP_000854753.1 TA system toxin CbtA family protein Toxin
EL018_RS19675 4048235..4048603 - 369 WP_001315620.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
EL018_RS19680 4048766..4048987 - 222 WP_000692345.1 DUF987 domain-containing protein -
EL018_RS19685 4049050..4049526 - 477 WP_001186774.1 RadC family protein -
EL018_RS19690 4049542..4049745 - 204 Protein_3817 antirestriction protein -
EL018_RS19695 4049767..4049832 + 66 Protein_3818 omptin family outer membrane protease -
EL018_RS19700 4049852..4050548 - 697 Protein_3819 IS1 family transposase -
EL018_RS23035 4050635..4050703 - 69 WP_211180522.1 protein YkiE -
EL018_RS19705 4050840..4051361 + 522 WP_001283626.1 RNA polymerase sigma factor FecI -
EL018_RS19710 4051358..4052311 + 954 WP_001068910.1 fec operon regulator FecR -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 4050061..4050354 293


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 14005.00 Da        Isoelectric Point: 8.2905

>T286684 WP_000854753.1 NZ_LR134082:c4048145-4047771 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13474.20 Da        Isoelectric Point: 6.2050

>AT286684 WP_001315620.1 NZ_LR134082:c4048603-4048235 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LVU0

Antitoxin

Source ID Structure
AlphaFold DB V0ULY5

References