Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4479273..4480108 Replicon chromosome
Accession NZ_LR134080
Organism Escherichia coli strain NCTC9082

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag EL023_RS22115 Protein ID WP_054518448.1
Coordinates 4479731..4480108 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag EL023_RS22110 Protein ID WP_057109690.1
Coordinates 4479273..4479641 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL023_RS22065 4475283..4475738 + 456 WP_000581493.1 hypothetical protein -
EL023_RS24965 4475857..4476068 - 212 Protein_4219 hypothetical protein -
EL023_RS22080 4476149..4476967 + 819 WP_057109691.1 DUF945 domain-containing protein -
EL023_RS22085 4476967..4477212 + 246 WP_001620925.1 hypothetical protein -
EL023_RS22090 4477306..4477785 + 480 WP_001442265.1 antirestriction protein -
EL023_RS22095 4477800..4478276 + 477 WP_001186756.1 RadC family protein -
EL023_RS22100 4478339..4478560 + 222 WP_044808382.1 DUF987 domain-containing protein -
EL023_RS22105 4478579..4479223 + 645 WP_016234190.1 hypothetical protein -
EL023_RS22110 4479273..4479641 + 369 WP_057109690.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
EL023_RS22115 4479731..4480108 + 378 WP_054518448.1 type IV toxin-antitoxin system toxin CbtA Toxin
EL023_RS22120 4480105..4480593 + 489 WP_054518447.1 hypothetical protein -
EL023_RS22125 4480613..4480810 + 198 WP_000772027.1 DUF957 domain-containing protein -
EL023_RS22130 4480895..4481743 + 849 WP_032198269.1 DUF4942 domain-containing protein -
EL023_RS22135 4481802..4482005 - 204 WP_047645199.1 hypothetical protein -
EL023_RS22140 4482015..4482665 - 651 Protein_4232 3-keto-L-gulonate-6-phosphate decarboxylase UlaD -
EL023_RS22145 4482679..4483143 - 465 WP_000776543.1 PTS ascorbate transporter subunit IIA -
EL023_RS22150 4483153..4483458 - 306 WP_000218362.1 PTS ascorbate transporter subunit IIB -
EL023_RS22155 4483474..4484871 - 1398 WP_001384980.1 PTS ascorbate transporter subunit IIC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - hlyD / hlyB / hlyA / hlyC 4407140..4482005 74865


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14016.99 Da        Isoelectric Point: 7.2435

>T286666 WP_054518448.1 NZ_LR134080:4479731-4480108 [Escherichia coli]
MKTLPVLPGQSASSRPSPVEIWQILLARLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNDITQGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13824.55 Da        Isoelectric Point: 6.4776

>AT286666 WP_057109690.1 NZ_LR134080:4479273-4479641 [Escherichia coli]
VSDSRHETNYPDDHNNRIWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGQFSDADAYHLEQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References