Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4271215..4272047 | Replicon | chromosome |
| Accession | NZ_LR134080 | ||
| Organism | Escherichia coli strain NCTC9082 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PD64 |
| Locus tag | EL023_RS20970 | Protein ID | WP_000854753.1 |
| Coordinates | 4271215..4271589 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | V0ULY5 |
| Locus tag | EL023_RS20975 | Protein ID | WP_001315620.1 |
| Coordinates | 4271679..4272047 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL023_RS20925 | 4266438..4267544 | + | 1107 | WP_001315214.1 | N-acetylneuraminate epimerase | - |
| EL023_RS20930 | 4267609..4268589 | + | 981 | WP_001295601.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
| EL023_RS20935 | 4268597..4269247 | - | 651 | WP_001037966.1 | HNH endonuclease | - |
| EL023_RS24835 | 4270284..4270436 | - | 153 | WP_001280445.1 | hypothetical protein | - |
| EL023_RS20960 | 4270521..4270718 | - | 198 | WP_000839281.1 | DUF957 domain-containing protein | - |
| EL023_RS20965 | 4270730..4271218 | - | 489 | WP_000777547.1 | hypothetical protein | - |
| EL023_RS20970 | 4271215..4271589 | - | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
| EL023_RS20975 | 4271679..4272047 | - | 369 | WP_001315620.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| EL023_RS20980 | 4272210..4272431 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| EL023_RS20985 | 4272494..4272970 | - | 477 | WP_001560709.1 | RadC family protein | - |
| EL023_RS20990 | 4272986..4273471 | - | 486 | WP_000849588.1 | antirestriction protein | - |
| EL023_RS20995 | 4273526..4274344 | - | 819 | WP_021535744.1 | DUF945 domain-containing protein | - |
| EL023_RS21005 | 4274444..4274677 | - | 234 | WP_001119729.1 | DUF905 family protein | - |
| EL023_RS21010 | 4274756..4275211 | - | 456 | WP_000581504.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fimE / fimB | 4262573..4297378 | 34805 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T286665 WP_000854753.1 NZ_LR134080:c4271589-4271215 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13474.20 Da Isoelectric Point: 6.2050
>AT286665 WP_001315620.1 NZ_LR134080:c4272047-4271679 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LVU0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0ULY5 |