Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 784884..785685 | Replicon | chromosome |
| Accession | NZ_LR134080 | ||
| Organism | Escherichia coli strain NCTC9082 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | D3GU15 |
| Locus tag | EL023_RS03840 | Protein ID | WP_001094429.1 |
| Coordinates | 784884..785261 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | EL023_RS03845 | Protein ID | WP_001285615.1 |
| Coordinates | 785308..785685 (-) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL023_RS03805 | 779965..780564 | + | 600 | WP_001255040.1 | type II secretion system minor pseudopilin GspJ | - |
| EL023_RS03810 | 780567..781544 | + | 978 | WP_000633238.1 | type II secretion system minor pseudopilin GspK | - |
| EL023_RS03815 | 781541..782719 | + | 1179 | WP_000094962.1 | type II secretion system protein GspL | - |
| EL023_RS03820 | 782721..783257 | + | 537 | WP_000942795.1 | GspM family type II secretion system protein YghD | - |
| EL023_RS03825 | 783538..784380 | - | 843 | WP_001280493.1 | DUF4942 domain-containing protein | - |
| EL023_RS03830 | 784465..784662 | - | 198 | WP_085949090.1 | DUF957 domain-containing protein | - |
| EL023_RS03835 | 784690..784887 | - | 198 | Protein_742 | hypothetical protein | - |
| EL023_RS03840 | 784884..785261 | - | 378 | WP_001094429.1 | TA system toxin CbtA family protein | Toxin |
| EL023_RS03845 | 785308..785685 | - | 378 | WP_001285615.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| EL023_RS03850 | 785765..785986 | - | 222 | WP_000692350.1 | DUF987 domain-containing protein | - |
| EL023_RS03855 | 786073..786548 | - | 476 | Protein_746 | RadC family protein | - |
| EL023_RS03860 | 786564..787037 | - | 474 | WP_000855081.1 | antirestriction protein | - |
| EL023_RS03870 | 787339..788157 | - | 819 | WP_001234605.1 | DUF945 domain-containing protein | - |
| EL023_RS03880 | 788257..788490 | - | 234 | WP_001119729.1 | DUF905 family protein | - |
| EL023_RS03885 | 788569..789024 | - | 456 | WP_000581502.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | gspC / gspD / gspE / gspF / gspG / gspH / gspI / gspJ / gspK / gspL / gspM / vipA/tssB / vipB/tssC / hcp/tssD / clpV/tssH / clbK | 689526..874408 | 184882 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13856.73 Da Isoelectric Point: 6.8601
>T286649 WP_001094429.1 NZ_LR134080:c785261-784884 [Escherichia coli]
MNTLPDTHVREASGCPSPITIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
MNTLPDTHVREASGCPSPITIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13687.58 Da Isoelectric Point: 6.6240
>AT286649 WP_001285615.1 NZ_LR134080:c785685-785308 [Escherichia coli]
VSDTLPGTTPPDDNHDRLWWGLPCTVTPCFGARLVQKGNRLHYLADRAGIKGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAAPATTV
VSDTLPGTTPPDDNHDRLWWGLPCTVTPCFGARLVQKGNRLHYLADRAGIKGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAAPATTV
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|