Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4902000..4902834 | Replicon | chromosome |
| Accession | NZ_LR134079 | ||
| Organism | Escherichia coli strain NCTC9112 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A8E0IX31 |
| Locus tag | EL053_RS24505 | Protein ID | WP_000854689.1 |
| Coordinates | 4902457..4902834 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | EL053_RS24500 | Protein ID | WP_001545732.1 |
| Coordinates | 4902000..4902380 (+) | Length | 127 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL053_RS24460 | 4898009..4898464 | + | 456 | WP_021528086.1 | hypothetical protein | - |
| EL053_RS27460 | 4898565..4898696 | + | 132 | WP_106108514.1 | DUF905 family protein | - |
| EL053_RS24470 | 4898875..4899696 | + | 822 | WP_021528087.1 | DUF945 domain-containing protein | - |
| EL053_RS24480 | 4900038..4900511 | + | 474 | WP_001387789.1 | antirestriction protein | - |
| EL053_RS24485 | 4900527..4901003 | + | 477 | WP_001186727.1 | RadC family protein | - |
| EL053_RS24490 | 4901066..4901287 | + | 222 | WP_000692330.1 | DUF987 domain-containing protein | - |
| EL053_RS24495 | 4901306..4901950 | + | 645 | WP_001545733.1 | hypothetical protein | - |
| EL053_RS24500 | 4902000..4902380 | + | 381 | WP_001545732.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| EL053_RS24505 | 4902457..4902834 | + | 378 | WP_000854689.1 | TA system toxin CbtA family protein | Toxin |
| EL053_RS24510 | 4902831..4903319 | + | 489 | WP_000761698.1 | hypothetical protein | - |
| EL053_RS24515 | 4903336..4903524 | + | 189 | WP_001545730.1 | DUF957 domain-containing protein | - |
| EL053_RS24520 | 4903638..4904456 | + | 819 | WP_001545729.1 | DUF4942 domain-containing protein | - |
| EL053_RS24525 | 4904515..4904718 | - | 204 | WP_001545728.1 | hypothetical protein | - |
| EL053_RS24530 | 4904728..4905378 | - | 651 | WP_000056760.1 | 3-keto-L-gulonate-6-phosphate decarboxylase UlaD | - |
| EL053_RS24535 | 4905392..4905856 | - | 465 | WP_000776510.1 | PTS ascorbate transporter subunit IIA | - |
| EL053_RS24540 | 4905866..4906171 | - | 306 | WP_000218362.1 | PTS ascorbate transporter subunit IIB | - |
| EL053_RS24545 | 4906187..4907584 | - | 1398 | WP_023154553.1 | PTS ascorbate transporter subunit IIC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14042.07 Da Isoelectric Point: 9.1510
>T286645 WP_000854689.1 NZ_LR134079:4902457-4902834 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 13994.73 Da Isoelectric Point: 5.0696
>AT286645 WP_001545732.1 NZ_LR134079:4902000-4902380 [Escherichia coli]
VSDTLSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFNNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
VSDTLSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFNNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|