Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4902000..4902834 Replicon chromosome
Accession NZ_LR134079
Organism Escherichia coli strain NCTC9112

Toxin (Protein)


Gene name yeeV Uniprot ID A0A8E0IX31
Locus tag EL053_RS24505 Protein ID WP_000854689.1
Coordinates 4902457..4902834 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag EL053_RS24500 Protein ID WP_001545732.1
Coordinates 4902000..4902380 (+) Length 127 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL053_RS24460 4898009..4898464 + 456 WP_021528086.1 hypothetical protein -
EL053_RS27460 4898565..4898696 + 132 WP_106108514.1 DUF905 family protein -
EL053_RS24470 4898875..4899696 + 822 WP_021528087.1 DUF945 domain-containing protein -
EL053_RS24480 4900038..4900511 + 474 WP_001387789.1 antirestriction protein -
EL053_RS24485 4900527..4901003 + 477 WP_001186727.1 RadC family protein -
EL053_RS24490 4901066..4901287 + 222 WP_000692330.1 DUF987 domain-containing protein -
EL053_RS24495 4901306..4901950 + 645 WP_001545733.1 hypothetical protein -
EL053_RS24500 4902000..4902380 + 381 WP_001545732.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
EL053_RS24505 4902457..4902834 + 378 WP_000854689.1 TA system toxin CbtA family protein Toxin
EL053_RS24510 4902831..4903319 + 489 WP_000761698.1 hypothetical protein -
EL053_RS24515 4903336..4903524 + 189 WP_001545730.1 DUF957 domain-containing protein -
EL053_RS24520 4903638..4904456 + 819 WP_001545729.1 DUF4942 domain-containing protein -
EL053_RS24525 4904515..4904718 - 204 WP_001545728.1 hypothetical protein -
EL053_RS24530 4904728..4905378 - 651 WP_000056760.1 3-keto-L-gulonate-6-phosphate decarboxylase UlaD -
EL053_RS24535 4905392..4905856 - 465 WP_000776510.1 PTS ascorbate transporter subunit IIA -
EL053_RS24540 4905866..4906171 - 306 WP_000218362.1 PTS ascorbate transporter subunit IIB -
EL053_RS24545 4906187..4907584 - 1398 WP_023154553.1 PTS ascorbate transporter subunit IIC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14042.07 Da        Isoelectric Point: 9.1510

>T286645 WP_000854689.1 NZ_LR134079:4902457-4902834 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 127 a.a.        Molecular weight: 13994.73 Da        Isoelectric Point: 5.0696

>AT286645 WP_001545732.1 NZ_LR134079:4902000-4902380 [Escherichia coli]
VSDTLSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFNNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE

Download         Length: 381 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References