Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4689873..4690705 Replicon chromosome
Accession NZ_LR134079
Organism Escherichia coli strain NCTC9112

Toxin (Protein)


Gene name yeeV Uniprot ID A7ZVJ9
Locus tag EL053_RS23285 Protein ID WP_000854765.1
Coordinates 4689873..4690247 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1NM52
Locus tag EL053_RS23290 Protein ID WP_001295723.1
Coordinates 4690337..4690705 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL053_RS23240 4685080..4686186 + 1107 WP_001315214.1 N-acetylneuraminate epimerase -
EL053_RS23245 4686251..4687231 + 981 WP_001295601.1 9-O-acetyl-N-acetylneuraminic acid deacetylase -
EL053_RS23250 4687239..4687889 - 651 WP_001037966.1 HNH endonuclease -
EL053_RS23260 4688268..4688453 + 186 WP_000066585.1 hypothetical protein -
EL053_RS27330 4688934..4689092 - 159 WP_001467148.1 hypothetical protein -
EL053_RS23275 4689192..4689368 - 177 WP_000839288.1 DUF957 domain-containing protein -
EL053_RS23280 4689385..4689876 - 492 WP_000976842.1 hypothetical protein -
EL053_RS23285 4689873..4690247 - 375 WP_000854765.1 TA system toxin CbtA family protein Toxin
EL053_RS23290 4690337..4690705 - 369 WP_001295723.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
EL053_RS23295 4690868..4691089 - 222 WP_000692345.1 DUF987 domain-containing protein -
EL053_RS23300 4691158..4691634 - 477 WP_001354275.1 RadC family protein -
EL053_RS23305 4691650..4692123 - 474 WP_001387789.1 antirestriction protein -
EL053_RS27440 4692312..4692464 - 153 WP_181042524.1 hypothetical protein -
EL053_RS23315 4692464..4693282 - 819 WP_001234651.1 DUF945 domain-containing protein -
EL053_RS23325 4693437..4693595 - 159 WP_001323397.1 DUF905 family protein -
EL053_RS23330 4693666..4694001 - 336 Protein_4492 autotransporter adhesin family protein -
EL053_RS23335 4694086..4694832 - 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13970.98 Da        Isoelectric Point: 7.2909

>T286643 WP_000854765.1 NZ_LR134079:c4690247-4689873 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13592.40 Da        Isoelectric Point: 6.6255

>AT286643 WP_001295723.1 NZ_LR134079:c4690705-4690337 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A7ZVJ9

Antitoxin

Source ID Structure
AlphaFold DB S1NM52

References