Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4689873..4690705 | Replicon | chromosome |
| Accession | NZ_LR134079 | ||
| Organism | Escherichia coli strain NCTC9112 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A7ZVJ9 |
| Locus tag | EL053_RS23285 | Protein ID | WP_000854765.1 |
| Coordinates | 4689873..4690247 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | EL053_RS23290 | Protein ID | WP_001295723.1 |
| Coordinates | 4690337..4690705 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL053_RS23240 | 4685080..4686186 | + | 1107 | WP_001315214.1 | N-acetylneuraminate epimerase | - |
| EL053_RS23245 | 4686251..4687231 | + | 981 | WP_001295601.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
| EL053_RS23250 | 4687239..4687889 | - | 651 | WP_001037966.1 | HNH endonuclease | - |
| EL053_RS23260 | 4688268..4688453 | + | 186 | WP_000066585.1 | hypothetical protein | - |
| EL053_RS27330 | 4688934..4689092 | - | 159 | WP_001467148.1 | hypothetical protein | - |
| EL053_RS23275 | 4689192..4689368 | - | 177 | WP_000839288.1 | DUF957 domain-containing protein | - |
| EL053_RS23280 | 4689385..4689876 | - | 492 | WP_000976842.1 | hypothetical protein | - |
| EL053_RS23285 | 4689873..4690247 | - | 375 | WP_000854765.1 | TA system toxin CbtA family protein | Toxin |
| EL053_RS23290 | 4690337..4690705 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| EL053_RS23295 | 4690868..4691089 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| EL053_RS23300 | 4691158..4691634 | - | 477 | WP_001354275.1 | RadC family protein | - |
| EL053_RS23305 | 4691650..4692123 | - | 474 | WP_001387789.1 | antirestriction protein | - |
| EL053_RS27440 | 4692312..4692464 | - | 153 | WP_181042524.1 | hypothetical protein | - |
| EL053_RS23315 | 4692464..4693282 | - | 819 | WP_001234651.1 | DUF945 domain-containing protein | - |
| EL053_RS23325 | 4693437..4693595 | - | 159 | WP_001323397.1 | DUF905 family protein | - |
| EL053_RS23330 | 4693666..4694001 | - | 336 | Protein_4492 | autotransporter adhesin family protein | - |
| EL053_RS23335 | 4694086..4694832 | - | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13970.98 Da Isoelectric Point: 7.2909
>T286643 WP_000854765.1 NZ_LR134079:c4690247-4689873 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT286643 WP_001295723.1 NZ_LR134079:c4690705-4690337 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|