Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4476133..4476683 Replicon chromosome
Accession NZ_LR134079
Organism Escherichia coli strain NCTC9112

Toxin (Protein)


Gene name ccdB Uniprot ID Q32K46
Locus tag EL053_RS22220 Protein ID WP_001160974.1
Coordinates 4476133..4476447 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag EL053_RS22225 Protein ID WP_000125566.1
Coordinates 4476450..4476683 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL053_RS22195 4471808..4473094 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
EL053_RS22200 4473094..4474083 + 990 WP_089610127.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
EL053_RS22205 4474080..4474901 + 822 WP_001065381.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
EL053_RS22210 4474904..4475281 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
EL053_RS22215 4475288..4476136 + 849 WP_000257188.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
EL053_RS22220 4476133..4476447 - 315 WP_001160974.1 CcdB family protein Toxin
EL053_RS22225 4476450..4476683 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
EL053_RS22230 4476769..4477248 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
EL053_RS22240 4477441..4479303 - 1863 WP_089610132.1 glutathione-regulated potassium-efflux system protein KefC -
EL053_RS22245 4479296..4479826 - 531 WP_072686445.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
EL053_RS22250 4479934..4481266 - 1333 Protein_4286 MFS transporter -
EL053_RS22255 4481325..4481612 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11737.84 Da        Isoelectric Point: 9.8517

>T286642 WP_001160974.1 NZ_LR134079:c4476447-4476133 [Escherichia coli]
MQFTVYRSRSRNAAFPFVIDVTSDIIGVINRRIVIPLTPIERFIRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT286642 WP_000125566.1 NZ_LR134079:c4476683-4476450 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LRR3

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References