Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) paaR-paaA-parE/-
Location 3376671..3377150 Replicon chromosome
Accession NZ_LR134079
Organism Escherichia coli strain NCTC9112

Toxin (Protein)


Gene name parE_1 Uniprot ID A0A3Y4Y761
Locus tag EL053_RS17090 Protein ID WP_032151266.1
Coordinates 3376863..3377150 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name paaA Uniprot ID A0A3Y4Y793
Locus tag EL053_RS17085 Protein ID WP_021577224.1
Coordinates 3376671..3376856 (+) Length 62 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL053_RS17035 3371863..3372177 - 315 WP_001300189.1 hypothetical protein -
EL053_RS17040 3372131..3372447 - 317 Protein_3288 DUF4752 family protein -
EL053_RS17045 3372437..3372739 - 303 WP_021577230.1 DUF4406 domain-containing protein -
EL053_RS17050 3372736..3373128 - 393 WP_016237929.1 DUF977 family protein -
EL053_RS17055 3373144..3373869 - 726 WP_021577237.1 DUF1627 domain-containing protein -
EL053_RS17060 3373903..3374364 - 462 WP_000139447.1 replication protein -
EL053_RS17065 3374357..3375367 - 1011 WP_126502621.1 DUF1376 domain-containing protein -
EL053_RS17070 3375454..3375891 - 438 WP_021577227.1 phage protein -
EL053_RS17075 3375895..3376176 - 282 WP_021577226.1 helix-turn-helix domain-containing protein -
EL053_RS17080 3376279..3376650 + 372 WP_021577225.1 hypothetical protein -
EL053_RS17085 3376671..3376856 + 186 WP_021577224.1 hypothetical protein Antitoxin
EL053_RS17090 3376863..3377150 + 288 WP_032151266.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
EL053_RS17095 3377433..3377585 + 153 WP_032151319.1 DUF1391 family protein -
EL053_RS17100 3378069..3378257 + 189 WP_000449172.1 cell division inhibitor -
EL053_RS17105 3378254..3378442 + 189 WP_000199480.1 DUF1482 family protein -
EL053_RS17110 3378538..3381009 + 2472 WP_062850906.1 exonuclease -
EL053_RS17115 3381077..3381319 + 243 WP_000273151.1 DUF4224 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 10959.63 Da        Isoelectric Point: 6.2092

>T286639 WP_032151266.1 NZ_LR134079:3376863-3377150 [Escherichia coli]
MLPVLWLESADTDLDDITSYIARFDINAAERLWQRLRACVLPLSEHPYLYPPSDRVPGLREIVAHPNYIILYRVTTSGIE
IVNVVHARRQFPITS

Download         Length: 288 bp

Antitoxin


Download         Length: 62 a.a.        Molecular weight: 7190.13 Da        Isoelectric Point: 5.1069

>AT286639 WP_021577224.1 NZ_LR134079:3376671-3376856 [Escherichia coli]
MNRALSPMVSEFETVEQENSYNEWLRAKVAASLADPRPAIPHDEVERRMAERFAEMRKERI

Download         Length: 186 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3Y4Y761

Antitoxin

Source ID Structure
AlphaFold DB A0A3Y4Y793

References