Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 2824403..2824929 | Replicon | chromosome |
| Accession | NZ_LR134079 | ||
| Organism | Escherichia coli strain NCTC9112 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | EL053_RS14100 | Protein ID | WP_000323025.1 |
| Coordinates | 2824403..2824690 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | EL053_RS14105 | Protein ID | WP_000534858.1 |
| Coordinates | 2824690..2824929 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL053_RS14055 | 2819427..2819642 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
| EL053_RS27540 | 2819862..2820032 | + | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
| EL053_RS14060 | 2820396..2820611 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
| EL053_RS14065 | 2820912..2821124 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
| EL053_RS14070 | 2821179..2821268 | + | 90 | WP_120795389.1 | hypothetical protein | - |
| EL053_RS14075 | 2821546..2822298 | - | 753 | WP_001047135.1 | antitermination protein | - |
| EL053_RS14080 | 2822312..2823361 | - | 1050 | WP_001265198.1 | DUF968 domain-containing protein | - |
| EL053_RS14085 | 2823363..2823641 | - | 279 | WP_012304870.1 | hypothetical protein | - |
| EL053_RS14090 | 2823708..2823959 | - | 252 | WP_000980994.1 | hypothetical protein | - |
| EL053_RS14095 | 2824176..2824331 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
| EL053_RS14100 | 2824403..2824690 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| EL053_RS14105 | 2824690..2824929 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| EL053_RS14110 | 2824954..2825259 | + | 306 | WP_001326990.1 | hypothetical protein | - |
| EL053_RS14115 | 2825463..2825774 | + | 312 | Protein_2726 | FlxA-like family protein | - |
| EL053_RS14120 | 2825810..2827018 | - | 1209 | WP_000343717.1 | IS256 family transposase | - |
| EL053_RS14125 | 2827555..2828868 | - | 1314 | WP_114493669.1 | ISNCY family transposase | - |
| EL053_RS27405 | 2829637..2829924 | - | 288 | Protein_2729 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2789039..2851836 | 62797 | |
| - | inside | Prophage | - | - | 2786388..2851836 | 65448 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T286638 WP_000323025.1 NZ_LR134079:c2824690-2824403 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|