Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2660201..2660839 | Replicon | chromosome |
Accession | NZ_LR134079 | ||
Organism | Escherichia coli strain NCTC9112 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A080J2T0 |
Locus tag | EL053_RS13325 | Protein ID | WP_000813793.1 |
Coordinates | 2660201..2660377 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | EL053_RS13330 | Protein ID | WP_001270286.1 |
Coordinates | 2660423..2660839 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL053_RS13305 | 2655823..2657034 | - | 1212 | WP_023154256.1 | BenE family transporter YdcO | - |
EL053_RS13310 | 2657087..2657623 | + | 537 | WP_000429150.1 | DNA-binding transcriptional regulator SutR | - |
EL053_RS13315 | 2657696..2659657 | + | 1962 | WP_024257894.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
EL053_RS13320 | 2659749..2659979 | - | 231 | WP_000494244.1 | YncJ family protein | - |
EL053_RS13325 | 2660201..2660377 | + | 177 | WP_000813793.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
EL053_RS13330 | 2660423..2660839 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
EL053_RS13335 | 2660918..2662324 | + | 1407 | WP_000760655.1 | PLP-dependent aminotransferase family protein | - |
EL053_RS13340 | 2662569..2663714 | + | 1146 | WP_000047419.1 | ABC transporter substrate-binding protein | - |
EL053_RS13345 | 2663732..2664745 | + | 1014 | WP_000220411.1 | ABC transporter ATP-binding protein | - |
EL053_RS13350 | 2664746..2665687 | + | 942 | WP_001251315.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6724.83 Da Isoelectric Point: 10.9223
>T286636 WP_000813793.1 NZ_LR134079:2660201-2660377 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGMRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGMRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT286636 WP_001270286.1 NZ_LR134079:2660423-2660839 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|