Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 3947199..3948013 | Replicon | chromosome |
Accession | NZ_LR134075 | ||
Organism | Escherichia coli strain NCTC9084 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | S1PA82 |
Locus tag | EL019_RS19280 | Protein ID | WP_001054376.1 |
Coordinates | 3947199..3947456 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | U9Z4B8 |
Locus tag | EL019_RS19285 | Protein ID | WP_001309181.1 |
Coordinates | 3947468..3948013 (+) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL019_RS19260 | 3942487..3943593 | + | 1107 | WP_001309184.1 | N-acetylneuraminate epimerase | - |
EL019_RS19265 | 3943658..3944638 | + | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
EL019_RS19270 | 3945221..3946461 | - | 1241 | Protein_3732 | helicase YjhR | - |
EL019_RS19275 | 3946577..3946822 | + | 246 | Protein_3733 | GNAT family N-acetyltransferase | - |
EL019_RS19280 | 3947199..3947456 | + | 258 | WP_001054376.1 | hypothetical protein | Toxin |
EL019_RS19285 | 3947468..3948013 | + | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
EL019_RS19290 | 3948069..3948815 | + | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
EL019_RS19295 | 3948984..3949202 | + | 219 | Protein_3737 | hypothetical protein | - |
EL019_RS22550 | 3949240..3949356 | + | 117 | Protein_3738 | VOC family protein | - |
EL019_RS19300 | 3949601..3950722 | + | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
EL019_RS19305 | 3950719..3950997 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB | - |
EL019_RS19310 | 3951009..3952322 | + | 1314 | WP_000460843.1 | galactitol-specific PTS transporter subunit IIC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fimB | 3939692..3956237 | 16545 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T286622 WP_001054376.1 NZ_LR134075:3947199-3947456 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT286622 WP_001309181.1 NZ_LR134075:3947468-3948013 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|