Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1776058..1776889 Replicon chromosome
Accession NZ_LR134075
Organism Escherichia coli strain NCTC9084

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag EL019_RS08495 Protein ID WP_000854814.1
Coordinates 1776058..1776432 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B3Y195
Locus tag EL019_RS08500 Protein ID WP_001285585.1
Coordinates 1776521..1776889 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL019_RS08455 1771454..1772620 + 1167 WP_001442313.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
EL019_RS08460 1772739..1773212 + 474 WP_001105414.1 DNA gyrase inhibitor SbmC -
EL019_RS08465 1773410..1774468 + 1059 WP_001200891.1 FUSC family protein -
EL019_RS08470 1774640..1774969 + 330 WP_000450409.1 DUF496 family protein -
EL019_RS08475 1775070..1775252 - 183 WP_001016348.1 hypothetical protein -
EL019_RS08480 1775324..1775452 + 129 Protein_1643 transposase domain-containing protein -
EL019_RS08485 1775741..1775854 - 114 WP_001161660.1 DUF957 domain-containing protein -
EL019_RS08490 1775867..1776061 - 195 WP_000988600.1 hypothetical protein -
EL019_RS08495 1776058..1776432 - 375 WP_000854814.1 type IV toxin-antitoxin system toxin CbtA Toxin
EL019_RS08500 1776521..1776889 - 369 WP_001285585.1 type IV toxin-antitoxin system toxin CbtA Antitoxin
EL019_RS08505 1776963..1777184 - 222 WP_000692323.1 DUF987 domain-containing protein -
EL019_RS08510 1777247..1777723 - 477 WP_001186773.1 RadC family protein -
EL019_RS08515 1777739..1777915 - 177 Protein_1650 antirestriction protein -
EL019_RS08520 1777903..1778489 - 587 Protein_1651 transposase -
EL019_RS08525 1778596..1779354 - 759 WP_033865565.1 hypothetical protein -
EL019_RS08530 1779368..1780582 - 1215 WP_000667429.1 DeoR family transcriptional regulator -
EL019_RS08535 1780778..1781116 - 339 Protein_1654 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T286610 WP_000854814.1 NZ_LR134075:c1776432-1776058 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13593.48 Da        Isoelectric Point: 6.3139

>AT286610 WP_001285585.1 NZ_LR134075:c1776889-1776521 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LW60

References