Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX(toxin) |
| Location | 4215952..4216766 | Replicon | chromosome |
| Accession | NZ_LR134031 | ||
| Organism | Escherichia coli strain NCTC11151 | ||
Toxin (Protein)
| Gene name | yjhX | Uniprot ID | S1PA82 |
| Locus tag | EL024_RS21015 | Protein ID | WP_001054376.1 |
| Coordinates | 4215952..4216209 (+) | Length | 86 a.a. |
Antitoxin (Protein)
| Gene name | yjhQ | Uniprot ID | A0A8E0IVE5 |
| Locus tag | EL024_RS21020 | Protein ID | WP_001350781.1 |
| Coordinates | 4216221..4216766 (+) | Length | 182 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL024_RS20995 | 4211240..4212346 | + | 1107 | WP_001309184.1 | N-acetylneuraminate epimerase | - |
| EL024_RS21000 | 4212411..4213391 | + | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
| EL024_RS21005 | 4213974..4215214 | - | 1241 | Protein_4048 | helicase YjhR | - |
| EL024_RS21010 | 4215330..4215575 | + | 246 | Protein_4049 | GNAT family N-acetyltransferase | - |
| EL024_RS21015 | 4215952..4216209 | + | 258 | WP_001054376.1 | hypothetical protein | Toxin |
| EL024_RS21020 | 4216221..4216766 | + | 546 | WP_001350781.1 | N-acetyltransferase | Antitoxin |
| EL024_RS21025 | 4216822..4217568 | + | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
| EL024_RS21030 | 4217737..4217955 | + | 219 | Protein_4053 | hypothetical protein | - |
| EL024_RS24825 | 4217993..4218109 | + | 117 | Protein_4054 | VOC family protein | - |
| EL024_RS21035 | 4218354..4219475 | + | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
| EL024_RS21040 | 4219472..4219750 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB | - |
| EL024_RS21045 | 4219762..4221075 | + | 1314 | WP_000460843.1 | galactitol-specific PTS transporter subunit IIC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fimI / fimA / fimE / fimB | 4205737..4224990 | 19253 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T286601 WP_001054376.1 NZ_LR134031:4215952-4216209 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19974.91 Da Isoelectric Point: 6.3277
>AT286601 WP_001350781.1 NZ_LR134031:4216221-4216766 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFGKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAFIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFGKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAFIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|