Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4014973..4015331 Replicon chromosome
Accession NZ_LR134031
Organism Escherichia coli strain NCTC11151

Toxin (Protein)


Gene name ccdB Uniprot ID -
Locus tag EL024_RS24820 Protein ID WP_001332330.1
Coordinates 4014973..4015095 (-) Length 41 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag EL024_RS19920 Protein ID WP_000125566.1
Coordinates 4015098..4015331 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL024_RS19890 4010455..4011741 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
EL024_RS19895 4011741..4012730 + 990 WP_000241229.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
EL024_RS19900 4012727..4013548 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
EL024_RS19905 4013551..4013928 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
EL024_RS19910 4013935..4014783 + 849 WP_000257201.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
EL024_RS24815 4014780..4014932 - 153 WP_146692624.1 CcdB family protein -
EL024_RS24820 4014973..4015095 - 123 WP_001332330.1 CcdB family protein Toxin
EL024_RS19920 4015098..4015331 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
EL024_RS19925 4015417..4015896 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
EL024_RS19930 4016088..4017950 - 1863 WP_000377122.1 glutathione-regulated potassium-efflux system protein KefC -
EL024_RS19935 4017943..4018473 - 531 WP_000600749.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
EL024_RS19940 4018581..4019912 - 1332 WP_001183207.1 MFS transporter -
EL024_RS19945 4019971..4020258 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-39)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 41 a.a.        Molecular weight: 4563.34 Da        Isoelectric Point: 10.9266

>T286595 WP_001332330.1 NZ_LR134031:c4015095-4014973 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIVGEINRRIVIPLTPI

Download         Length: 123 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT286595 WP_000125566.1 NZ_LR134031:c4015331-4015098 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References