Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4003777..4004611 | Replicon | chromosome |
| Accession | NZ_LR134000 | ||
| Organism | Escherichia coli strain NCTC9066 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1J6XFW9 |
| Locus tag | EL014_RS19510 | Protein ID | WP_000854770.1 |
| Coordinates | 4003777..4004154 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | EL014_RS19515 | Protein ID | WP_001332042.1 |
| Coordinates | 4004243..4004611 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL014_RS19475 | 3999405..4000151 | - | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| EL014_RS19480 | 4000166..4001707 | - | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| EL014_RS19490 | 4002301..4002477 | - | 177 | Protein_3774 | helix-turn-helix domain-containing protein | - |
| EL014_RS22670 | 4002841..4002999 | - | 159 | WP_001467148.1 | hypothetical protein | - |
| EL014_RS19500 | 4003099..4003275 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| EL014_RS19505 | 4003292..4003780 | - | 489 | WP_000761690.1 | hypothetical protein | - |
| EL014_RS19510 | 4003777..4004154 | - | 378 | WP_000854770.1 | TA system toxin CbtA family protein | Toxin |
| EL014_RS19515 | 4004243..4004611 | - | 369 | WP_001332042.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| EL014_RS19520 | 4004774..4004995 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| EL014_RS19525 | 4005058..4005534 | - | 477 | WP_001186779.1 | RadC family protein | - |
| EL014_RS19530 | 4005550..4006014 | - | 465 | WP_000855061.1 | antirestriction protein | - |
| EL014_RS19540 | 4006356..4007174 | - | 819 | WP_126315351.1 | DUF945 domain-containing protein | - |
| EL014_RS19550 | 4007329..4007487 | - | 159 | WP_001323397.1 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14196.37 Da Isoelectric Point: 8.7438
>T286577 WP_000854770.1 NZ_LR134000:c4004154-4003777 [Escherichia coli]
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13677.38 Da Isoelectric Point: 6.5931
>AT286577 WP_001332042.1 NZ_LR134000:c4004611-4004243 [Escherichia coli]
VSDTLSGTTHPDDNHDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
VSDTLSGTTHPDDNHDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|