Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 3969889..3970709 | Replicon | chromosome |
Accession | NZ_LR134000 | ||
Organism | Escherichia coli strain NCTC9066 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | B6I030 |
Locus tag | EL014_RS19340 | Protein ID | WP_001054379.1 |
Coordinates | 3969889..3970146 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | - |
Locus tag | EL014_RS19345 | Protein ID | WP_000123957.1 |
Coordinates | 3970158..3970709 (+) | Length | 184 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL014_RS19320 | 3965176..3966282 | + | 1107 | WP_001295733.1 | N-acetylneuraminate epimerase | - |
EL014_RS19325 | 3966346..3967326 | + | 981 | WP_000991462.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
EL014_RS19330 | 3967909..3969135 | - | 1227 | Protein_3743 | helicase YjhR | - |
EL014_RS19335 | 3969213..3969512 | + | 300 | WP_001332034.1 | GNAT family N-acetyltransferase | - |
EL014_RS19340 | 3969889..3970146 | + | 258 | WP_001054379.1 | YjhX family toxin | Toxin |
EL014_RS19345 | 3970158..3970709 | + | 552 | WP_000123957.1 | N-acetyltransferase | Antitoxin |
EL014_RS19350 | 3970761..3971507 | + | 747 | WP_000354249.1 | class I SAM-dependent methyltransferase | - |
EL014_RS19355 | 3971635..3971895 | + | 261 | WP_000077645.1 | hypothetical protein | - |
EL014_RS22765 | 3971933..3972049 | + | 117 | Protein_3749 | VOC family protein | - |
EL014_RS19360 | 3972294..3973415 | + | 1122 | WP_000010833.1 | M42 family metallopeptidase | - |
EL014_RS19365 | 3973412..3973690 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB | - |
EL014_RS19370 | 3973702..3975015 | + | 1314 | WP_000460845.1 | galactitol-specific PTS transporter subunit IIC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fimB | 3962384..3978930 | 16546 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9568.07 Da Isoelectric Point: 11.1381
>T286576 WP_001054379.1 NZ_LR134000:3969889-3970146 [Escherichia coli]
MNLSRQEQRTLHVLAKGGRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QLDNR
MNLSRQEQRTLHVLAKGGRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 184 a.a. Molecular weight: 20358.34 Da Isoelectric Point: 6.4182
>AT286576 WP_000123957.1 NZ_LR134000:3970158-3970709 [Escherichia coli]
MTAHHFTFQITDESDASDIREVETRAFGFSKEADLTASLLEDESARPALSLLARHEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQALTA
QPMNVTGHIQCAQALMKPEHWRE
MTAHHFTFQITDESDASDIREVETRAFGFSKEADLTASLLEDESARPALSLLARHEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQALTA
QPMNVTGHIQCAQALMKPEHWRE
Download Length: 552 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|