Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2404218..2404856 | Replicon | chromosome |
Accession | NZ_LR134000 | ||
Organism | Escherichia coli strain NCTC9066 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | EL014_RS11725 | Protein ID | WP_000813794.1 |
Coordinates | 2404680..2404856 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | EL014_RS11720 | Protein ID | WP_001270286.1 |
Coordinates | 2404218..2404634 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL014_RS11700 | 2399370..2400311 | - | 942 | WP_001251313.1 | ABC transporter permease | - |
EL014_RS11705 | 2400312..2401325 | - | 1014 | WP_000220399.1 | ABC transporter ATP-binding protein | - |
EL014_RS11710 | 2401343..2402488 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
EL014_RS11715 | 2402733..2404139 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
EL014_RS11720 | 2404218..2404634 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
EL014_RS11725 | 2404680..2404856 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
EL014_RS11730 | 2405078..2405308 | + | 231 | WP_000494244.1 | YncJ family protein | - |
EL014_RS11735 | 2405400..2407361 | - | 1962 | WP_001301045.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
EL014_RS11740 | 2407434..2407970 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
EL014_RS11745 | 2408023..2409237 | + | 1215 | WP_001326689.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T286570 WP_000813794.1 NZ_LR134000:c2404856-2404680 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT286570 WP_001270286.1 NZ_LR134000:c2404634-2404218 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|