Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 2948148..2948771 | Replicon | chromosome |
| Accession | NZ_LR133996 | ||
| Organism | Shimwellia blattae strain NCTC10965 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | I2BBN0 |
| Locus tag | EL017_RS14200 | Protein ID | WP_002438965.1 |
| Coordinates | 2948553..2948771 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | I2BBM9 |
| Locus tag | EL017_RS14195 | Protein ID | WP_002438967.1 |
| Coordinates | 2948148..2948528 (+) | Length | 127 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL017_RS14185 | 2943266..2944441 | + | 1176 | WP_002438970.1 | efflux RND transporter periplasmic adaptor subunit | - |
| EL017_RS14190 | 2944464..2947619 | + | 3156 | WP_002438968.1 | multidrug efflux RND transporter permease subunit | - |
| EL017_RS14195 | 2948148..2948528 | + | 381 | WP_002438967.1 | Hha toxicity modulator TomB | Antitoxin |
| EL017_RS14200 | 2948553..2948771 | + | 219 | WP_002438965.1 | hemolysin expression modulator Hha | Toxin |
| EL017_RS14205 | 2949164..2949637 | + | 474 | WP_002438964.1 | YlaC family protein | - |
| EL017_RS14215 | 2949846..2950280 | + | 435 | WP_164558553.1 | MGMT family protein | - |
| EL017_RS14220 | 2950332..2950862 | - | 531 | WP_002438961.1 | YbaY family lipoprotein | - |
| EL017_RS14225 | 2951070..2951933 | + | 864 | WP_002438960.1 | acyl-CoA thioesterase II | - |
| EL017_RS14230 | 2951982..2953262 | - | 1281 | WP_002438958.1 | ammonium transporter AmtB | - |
| EL017_RS14235 | 2953293..2953631 | - | 339 | WP_002438956.1 | P-II family nitrogen regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8600.97 Da Isoelectric Point: 8.9008
>T286557 WP_002438965.1 NZ_LR133996:2948553-2948771 [Shimwellia blattae]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDTELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDTELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 14653.43 Da Isoelectric Point: 4.7334
>AT286557 WP_002438967.1 NZ_LR133996:2948148-2948528 [Shimwellia blattae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLGETNRGWVNDPTSAINLQLNDLIEHIATFALNYKIKYDDDSKLIEQIDEYL
DDTFTLFSNYGIDAKDLQKWQKSGNRLFRCFVNASRANPVSLSLEK
MDEYSPKRHDIAQLRFLCETLYHDCLANLGETNRGWVNDPTSAINLQLNDLIEHIATFALNYKIKYDDDSKLIEQIDEYL
DDTFTLFSNYGIDAKDLQKWQKSGNRLFRCFVNASRANPVSLSLEK
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|