Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 2180221..2180772 Replicon chromosome
Accession NZ_LR133996
Organism Shimwellia blattae strain NCTC10965

Toxin (Protein)


Gene name ccdB Uniprot ID I2B9K3
Locus tag EL017_RS10435 Protein ID WP_002443590.1
Coordinates 2180221..2180538 (-) Length 106 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID I2B9K4
Locus tag EL017_RS10440 Protein ID WP_002443589.1
Coordinates 2180542..2180772 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL017_RS10400 2175409..2175621 - 213 WP_002443597.1 hypothetical protein -
EL017_RS10405 2175722..2176336 - 615 WP_002443596.1 membrane integrity-associated transporter subunit PqiC -
EL017_RS10410 2176333..2177241 - 909 WP_002443595.1 MCE family protein -
EL017_RS10415 2177243..2178016 - 774 WP_002443594.1 ATP-binding cassette domain-containing protein -
EL017_RS10420 2178019..2179147 - 1129 Protein_1999 ABC transporter permease -
EL017_RS10425 2179358..2179648 + 291 WP_002443592.1 hypothetical protein -
EL017_RS10430 2179691..2179936 - 246 WP_002443591.1 YfdY family protein -
EL017_RS10435 2180221..2180538 - 318 WP_002443590.1 CcdB family protein Toxin
EL017_RS10440 2180542..2180772 - 231 WP_002443589.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
EL017_RS10445 2180956..2181594 - 639 WP_002443588.1 leucine efflux protein LeuE -
EL017_RS10450 2181766..2182296 - 531 WP_002443587.1 cytochrome b561 -
EL017_RS19950 2182459..2183513 - 1055 Protein_2006 DUF3418 domain-containing protein -
EL017_RS20005 2184267..2185472 - 1206 Protein_2007 ATP-dependent RNA helicase HrpA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-104)

Antitoxin

Post-segregation antitoxin CcdA

(7-76)


Sequences

Toxin        


Download         Length: 106 a.a.        Molecular weight: 11725.67 Da        Isoelectric Point: 5.0491

>T286556 WP_002443590.1 NZ_LR133996:c2180538-2180221 [Shimwellia blattae]
MQFTIYRNPGRSSLYPLLIDVTSDIIGALNTRIVIPLLPVERYPNPEVRPVRLNPVLELIDGKQYALMTHELASIPLKAL
GAEFCDGSEYRQTVKGALDFILDGI

Download         Length: 318 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8613.57 Da        Isoelectric Point: 6.8798

>AT286556 WP_002443589.1 NZ_LR133996:c2180772-2180542 [Shimwellia blattae]
MKQRTTQSVTVTLERDLIAAARAAGVNMSQTLAAALDAELKKHASTRWKEENREGLEALNRFHDEHGHFSDDYRAF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB I2B9K3

Antitoxin

Source ID Structure
AlphaFold DB I2B9K4

References