Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1891219..1891976 | Replicon | chromosome |
| Accession | NZ_LR133996 | ||
| Organism | Shimwellia blattae strain NCTC10965 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | EL017_RS09010 | Protein ID | WP_002443842.1 |
| Coordinates | 1891494..1891976 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | I2B8R4 |
| Locus tag | EL017_RS09005 | Protein ID | WP_002443844.1 |
| Coordinates | 1891219..1891503 (+) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL017_RS08990 | 1887909..1888349 | + | 441 | WP_002443850.1 | hypothetical protein | - |
| EL017_RS08995 | 1888369..1889460 | - | 1092 | WP_174270567.1 | MBL fold metallo-hydrolase | - |
| EL017_RS09000 | 1889626..1891140 | + | 1515 | WP_002443846.1 | PLP-dependent aminotransferase family protein | - |
| EL017_RS09005 | 1891219..1891503 | + | 285 | WP_002443844.1 | DUF1778 domain-containing protein | Antitoxin |
| EL017_RS09010 | 1891494..1891976 | + | 483 | WP_002443842.1 | GNAT family N-acetyltransferase | Toxin |
| EL017_RS09015 | 1892249..1893593 | + | 1345 | Protein_1729 | carbohydrate porin | - |
| EL017_RS09020 | 1893629..1894087 | - | 459 | WP_002443838.1 | multidrug/biocide efflux PACE transporter | - |
| EL017_RS09025 | 1894185..1895063 | + | 879 | WP_002443836.1 | LysR family transcriptional regulator | - |
| EL017_RS09030 | 1895117..1896043 | - | 927 | WP_002443834.1 | omptin family outer membrane protease | - |
| EL017_RS09035 | 1896318..1896802 | - | 485 | Protein_1733 | [NiFe]-hydrogenase assembly chaperone HybE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17869.73 Da Isoelectric Point: 8.2935
>T286554 WP_002443842.1 NZ_LR133996:1891494-1891976 [Shimwellia blattae]
MEINVTAPALLTEDHILQPFDCGNDILSDWLRRRAIKNQHLNASRTFVICLEGTKRVVGYYSIATGSVSHIDLGRSLRKN
MPDPVPVVLLGRLAVDVCTQGNSFGKWMLNDAVMRVSNLADQVGIKAIMVHAINDEAKAFYEHFGFVQSPLTPRTLFFKI
MEINVTAPALLTEDHILQPFDCGNDILSDWLRRRAIKNQHLNASRTFVICLEGTKRVVGYYSIATGSVSHIDLGRSLRKN
MPDPVPVVLLGRLAVDVCTQGNSFGKWMLNDAVMRVSNLADQVGIKAIMVHAINDEAKAFYEHFGFVQSPLTPRTLFFKI
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|