Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 1595937..1596527 | Replicon | chromosome |
Accession | NZ_LR133996 | ||
Organism | Shimwellia blattae strain NCTC10965 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | I2B7X3 |
Locus tag | EL017_RS07510 | Protein ID | WP_002440075.1 |
Coordinates | 1596195..1596527 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | I2B7X2 |
Locus tag | EL017_RS07505 | Protein ID | WP_002440074.1 |
Coordinates | 1595937..1596194 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL017_RS07480 | 1591122..1592570 | - | 1449 | WP_002440068.1 | AMP nucleosidase | - |
EL017_RS07490 | 1593705..1594622 | + | 918 | WP_002440070.1 | nitrogen assimilation transcriptional regulator NAC | - |
EL017_RS07495 | 1594728..1595678 | + | 951 | WP_002440072.1 | HTH-type transcriptional regulator Cbl | - |
EL017_RS07505 | 1595937..1596194 | + | 258 | WP_002440074.1 | hypothetical protein | Antitoxin |
EL017_RS07510 | 1596195..1596527 | + | 333 | WP_002440075.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
EL017_RS07520 | 1596769..1597554 | - | 786 | WP_002440077.1 | DgsA anti-repressor MtfA | - |
EL017_RS07530 | 1597911..1598549 | + | 639 | WP_002440078.1 | GrpB family protein | - |
EL017_RS07535 | 1598695..1598958 | + | 264 | WP_034920043.1 | hypothetical protein | - |
EL017_RS07540 | 1599131..1600567 | + | 1437 | WP_174270544.1 | DNA cytosine methyltransferase | - |
EL017_RS07545 | 1600551..1601024 | + | 474 | WP_002440083.1 | DNA mismatch endonuclease Vsr | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11760.52 Da Isoelectric Point: 10.2965
>T286549 WP_002440075.1 NZ_LR133996:1596195-1596527 [Shimwellia blattae]
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSKASFNTFTRLPVVVPVTSGGNFARTAGFAVSLDGAGTKTTGVIRCDQPRTI
DMAARNGKRLERLPDAVVNEVLARLEAILS
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSKASFNTFTRLPVVVPVTSGGNFARTAGFAVSLDGAGTKTTGVIRCDQPRTI
DMAARNGKRLERLPDAVVNEVLARLEAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|