Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 1491080..1491606 | Replicon | chromosome |
Accession | NZ_LR133996 | ||
Organism | Shimwellia blattae strain NCTC10965 |
Toxin (Protein)
Gene name | relE | Uniprot ID | I2B7N1 |
Locus tag | EL017_RS07030 | Protein ID | WP_002439942.1 |
Coordinates | 1491319..1491606 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | I2B7N0 |
Locus tag | EL017_RS07025 | Protein ID | WP_002439941.1 |
Coordinates | 1491080..1491319 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL017_RS07005 | 1486430..1487218 | + | 789 | WP_002439937.1 | hydroxyethylthiazole kinase | - |
EL017_RS07010 | 1487221..1488024 | + | 804 | WP_034920040.1 | bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase | - |
EL017_RS07015 | 1488181..1489233 | + | 1053 | WP_002439939.1 | class I fructose-bisphosphate aldolase | - |
EL017_RS07020 | 1489458..1490828 | - | 1371 | WP_002439940.1 | tRNA 5-hydroxyuridine modification protein YegQ | - |
EL017_RS07025 | 1491080..1491319 | + | 240 | WP_002439941.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
EL017_RS07030 | 1491319..1491606 | + | 288 | WP_002439942.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL017_RS07035 | 1491683..1492408 | - | 726 | WP_002439943.1 | two-component system response regulator BaeR | - |
EL017_RS07040 | 1492405..1493799 | - | 1395 | WP_002439944.1 | two-component system sensor histidine kinase BaeS | - |
EL017_RS07045 | 1493799..1495214 | - | 1416 | WP_002439945.1 | multidrug transporter subunit MdtD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11183.14 Da Isoelectric Point: 10.2262
>T286548 WP_002439942.1 NZ_LR133996:1491319-1491606 [Shimwellia blattae]
MAYFLDFDERALKEWRKLGSTVREQFKKKLAEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDAQVVVFVISVGK
RERPEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQFKKKLAEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDAQVVVFVISVGK
RERPEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|