Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4542708..4543224 | Replicon | chromosome |
Accession | NZ_LR133964 | ||
Organism | Klebsiella pneumoniae strain NCTC11359 |
Toxin (Protein)
Gene name | relE | Uniprot ID | R4YAY3 |
Locus tag | EL047_RS22570 | Protein ID | WP_004178374.1 |
Coordinates | 4542708..4542992 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | EL047_RS22575 | Protein ID | WP_002886901.1 |
Coordinates | 4542982..4543224 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL047_RS22550 | 4538104..4538412 | - | 309 | WP_012737232.1 | PTS sugar transporter subunit IIB | - |
EL047_RS25835 | 4538497..4538670 | + | 174 | WP_069196977.1 | hypothetical protein | - |
EL047_RS22555 | 4538673..4539416 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
EL047_RS22560 | 4539773..4541911 | + | 2139 | WP_004222153.1 | anaerobic ribonucleoside-triphosphate reductase | - |
EL047_RS22565 | 4542240..4542704 | + | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
EL047_RS22570 | 4542708..4542992 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL047_RS22575 | 4542982..4543224 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
EL047_RS22580 | 4543302..4545212 | - | 1911 | WP_009486549.1 | BglG family transcription antiterminator | - |
EL047_RS22585 | 4545235..4546389 | - | 1155 | WP_023159544.1 | lactonase family protein | - |
EL047_RS22590 | 4546456..4547196 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T286538 WP_004178374.1 NZ_LR133964:c4542992-4542708 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A6THG1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |