Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1607489..1608108 | Replicon | chromosome |
Accession | NZ_LR133932 | ||
Organism | Klebsiella oxytoca strain NCTC11356 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H3N9D8 |
Locus tag | EL063_RS07625 | Protein ID | WP_004099646.1 |
Coordinates | 1607489..1607707 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | EL063_RS07630 | Protein ID | WP_004099648.1 |
Coordinates | 1607734..1608108 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL063_RS07595 | 1603525..1603788 | + | 264 | WP_004099638.1 | type B 50S ribosomal protein L31 | - |
EL063_RS07600 | 1603788..1603928 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
EL063_RS07605 | 1603925..1604623 | - | 699 | WP_004099639.1 | GNAT family N-acetyltransferase | - |
EL063_RS07610 | 1604726..1606180 | + | 1455 | WP_126488646.1 | PLP-dependent aminotransferase family protein | - |
EL063_RS07615 | 1606155..1606625 | - | 471 | WP_004099643.1 | YlaC family protein | - |
EL063_RS07620 | 1606762..1607328 | - | 567 | WP_023320460.1 | maltose O-acetyltransferase | - |
EL063_RS07625 | 1607489..1607707 | - | 219 | WP_004099646.1 | hemolysin expression modulator Hha | Toxin |
EL063_RS07630 | 1607734..1608108 | - | 375 | WP_004099648.1 | Hha toxicity modulator TomB | Antitoxin |
EL063_RS07635 | 1608590..1611736 | - | 3147 | WP_004099650.1 | multidrug efflux RND transporter permease subunit | - |
EL063_RS07640 | 1611759..1612952 | - | 1194 | WP_004111040.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8640.05 Da Isoelectric Point: 8.9008
>T286520 WP_004099646.1 NZ_LR133932:c1607707-1607489 [Klebsiella oxytoca]
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14350.09 Da Isoelectric Point: 4.8989
>AT286520 WP_004099648.1 NZ_LR133932:c1608108-1607734 [Klebsiella oxytoca]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLVTQLDEYL
DDTFVLFSNYGINTADLQKWRKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLVTQLDEYL
DDTFVLFSNYGINTADLQKWRKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|