Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 839272..839749 Replicon chromosome
Accession NZ_LR133917
Organism Staphylococcus aureus strain NCTC8317

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag ELZ45_RS04235 Protein ID WP_000052076.1
Coordinates 839272..839460 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag ELZ45_RS04240 Protein ID WP_001059690.1
Coordinates 839489..839749 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ELZ45_RS04205 835263..835784 + 522 WP_000824484.1 hypothetical protein -
ELZ45_RS04210 836125..836811 + 687 WP_000141557.1 thermonuclease family protein -
ELZ45_RS04215 837168..837368 + 201 WP_001059082.1 cold-shock protein -
ELZ45_RS04220 837863..838081 - 219 WP_000005884.1 hypothetical protein -
ELZ45_RS04225 838143..838427 - 285 WP_001004399.1 hypothetical protein -
ELZ45_RS04230 838515..839084 - 570 WP_001106655.1 hypothetical protein -
ELZ45_RS04235 839272..839460 - 189 WP_000052076.1 hypothetical protein Toxin
ELZ45_RS04240 839489..839749 - 261 WP_001059690.1 hypothetical protein Antitoxin
ELZ45_RS04245 840090..840293 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
ELZ45_RS04250 840290..840526 - 237 WP_000368687.1 hypothetical protein -
ELZ45_RS04255 840751..841332 + 582 WP_001140693.1 phosphoglycerate mutase family protein -
ELZ45_RS04260 841405..842022 - 618 WP_000255561.1 LysE/ArgO family amino acid transporter -
ELZ45_RS04265 842177..842671 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
ELZ45_RS04270 843070..843492 - 423 WP_000974455.1 organic hydroperoxide resistance protein -
ELZ45_RS04275 843640..844356 + 717 WP_000150018.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T286506 WP_000052076.1 NZ_LR133917:c839460-839272 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT286506 WP_001059690.1 NZ_LR133917:c839749-839489 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References