Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 59735..60872 | Replicon | plasmid 2 |
Accession | NZ_LR132068 | ||
Organism | Enterococcus faecium isolate E0139 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | D1MAU9 |
Locus tag | ELZ42_RS12890 | Protein ID | WP_002333464.1 |
Coordinates | 60009..60872 (+) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | R2XCR7 |
Locus tag | ELZ42_RS12885 | Protein ID | WP_000301765.1 |
Coordinates | 59735..60007 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ELZ42_RS12840 | 55238..56836 | + | 1599 | WP_126340550.1 | type IA DNA topoisomerase | - |
ELZ42_RS12845 | 56962..57126 | + | 165 | WP_002935077.1 | peptide-binding protein | - |
ELZ42_RS12850 | 57147..57242 | + | 96 | WP_001809736.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
ELZ42_RS12855 | 57367..58104 | + | 738 | WP_002292226.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
ELZ42_RS12865 | 58250..58534 | + | 285 | WP_078100292.1 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
ELZ42_RS12870 | 58679..58945 | + | 267 | WP_126340551.1 | AAA family ATPase | - |
ELZ42_RS12875 | 58949..59404 | + | 456 | Protein_63 | ParA family protein | - |
ELZ42_RS12880 | 59509..59718 | + | 210 | WP_000527317.1 | peptide-binding protein | - |
ELZ42_RS12885 | 59735..60007 | + | 273 | WP_000301765.1 | antitoxin | Antitoxin |
ELZ42_RS12890 | 60009..60872 | + | 864 | WP_002333464.1 | zeta toxin family protein | Toxin |
ELZ42_RS12895 | 61313..61630 | + | 318 | WP_002333463.1 | hypothetical protein | - |
ELZ42_RS12900 | 62164..62661 | + | 498 | WP_002325587.1 | hypothetical protein | - |
ELZ42_RS12905 | 62695..62967 | + | 273 | WP_002325586.1 | hypothetical protein | - |
ELZ42_RS12910 | 62997..63677 | - | 681 | WP_002332989.1 | IS6 family transposase | - |
ELZ42_RS12920 | 64106..64528 | + | 423 | WP_002307506.1 | cupin domain-containing protein | - |
ELZ42_RS12925 | 64612..65265 | + | 654 | WP_002307505.1 | ATP-binding cassette domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | vat(D) / erm(B) / VanHAX | - | 1..141895 | 141895 | |
- | inside | IScluster/Tn | vat(D) / erm(B) | - | 53015..67642 | 14627 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32370.87 Da Isoelectric Point: 6.6610
>T286505 WP_002333464.1 NZ_LR132068:60009-60872 [Enterococcus faecium]
MANIVNFTDKQFENRLNDNLEELVQGKKAVESPTAFLLGGQPGSGKTSLRSAILEETQGNVIVIDNDTFKQQHPNFDELA
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKLESLQPPTPPIPKTPKLPGL
MANIVNFTDKQFENRLNDNLEELVQGKKAVESPTAFLLGGQPGSGKTSLRSAILEETQGNVIVIDNDTFKQQHPNFDELA
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKLESLQPPTPPIPKTPKLPGL
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | D1MAU9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829F0A3 |