Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 470465..471036 | Replicon | chromosome |
Accession | NZ_LR132067 | ||
Organism | Enterococcus faecium isolate E0139 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | ELZ42_RS02425 | Protein ID | WP_002328559.1 |
Coordinates | 470695..471036 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A828ZZN9 |
Locus tag | ELZ42_RS02420 | Protein ID | WP_002323011.1 |
Coordinates | 470465..470695 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ELZ42_RS02375 | 465583..466911 | + | 1329 | WP_002327663.1 | FAD-containing oxidoreductase | - |
ELZ42_RS02380 | 466933..467559 | + | 627 | WP_002286816.1 | cysteine hydrolase | - |
ELZ42_RS02385 | 467742..468323 | + | 582 | WP_002286813.1 | TetR/AcrR family transcriptional regulator | - |
ELZ42_RS02405 | 469055..469630 | + | 576 | WP_002327664.1 | SOS response-associated peptidase family protein | - |
ELZ42_RS02410 | 469831..470205 | - | 375 | WP_158225605.1 | hypothetical protein | - |
ELZ42_RS02420 | 470465..470695 | + | 231 | WP_002323011.1 | hypothetical protein | Antitoxin |
ELZ42_RS02425 | 470695..471036 | + | 342 | WP_002328559.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
ELZ42_RS02430 | 471855..473017 | + | 1163 | WP_086956687.1 | IS3 family transposase | - |
ELZ42_RS02440 | 473148..474332 | + | 1185 | Protein_448 | hypothetical protein | - |
ELZ42_RS02445 | 474332..475645 | + | 1314 | WP_002328556.1 | LPXTG-protein cell wall anchor protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13278.70 Da Isoelectric Point: 10.1461
>T286504 WP_002328559.1 NZ_LR132067:470695-471036 [Enterococcus faecium]
VSGERIYIPKKGDIVWIYFDPSLGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIISQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
VSGERIYIPKKGDIVWIYFDPSLGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIISQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|