Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-PHD |
Location | 1852788..1853473 | Replicon | chromosome |
Accession | NZ_LR131273 | ||
Organism | Tsukamurella paurometabola strain NCTC10741 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | ELY19_RS09280 | Protein ID | WP_164711568.1 |
Coordinates | 1852788..1853186 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | ELY19_RS09285 | Protein ID | WP_126195936.1 |
Coordinates | 1853192..1853473 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ELY19_RS09245 | 1848692..1849516 | - | 825 | WP_126195929.1 | Rv3717 family N-acetylmuramoyl-L-alanine amidase | - |
ELY19_RS09250 | 1849610..1849918 | + | 309 | WP_126195930.1 | YbaB/EbfC family nucleoid-associated protein | - |
ELY19_RS09255 | 1849929..1850582 | + | 654 | WP_126195931.1 | recombination mediator RecR | - |
ELY19_RS09260 | 1850586..1851134 | + | 549 | WP_126195932.1 | hypothetical protein | - |
ELY19_RS09265 | 1851194..1851763 | + | 570 | WP_126198767.1 | DinB family protein | - |
ELY19_RS09270 | 1851773..1852261 | + | 489 | WP_126195933.1 | SRPBCC family protein | - |
ELY19_RS09275 | 1852263..1852787 | + | 525 | WP_126195934.1 | methylated-DNA--[protein]-cysteine S-methyltransferase | - |
ELY19_RS09280 | 1852788..1853186 | - | 399 | WP_164711568.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
ELY19_RS09285 | 1853192..1853473 | - | 282 | WP_126195936.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
ELY19_RS09290 | 1853835..1854542 | - | 708 | WP_126198768.1 | glutamine amidotransferase | - |
ELY19_RS09295 | 1854569..1855816 | - | 1248 | WP_126195937.1 | Mur ligase family protein | - |
ELY19_RS09300 | 1855855..1856601 | + | 747 | WP_126195938.1 | class I SAM-dependent methyltransferase | - |
ELY19_RS09305 | 1856488..1857483 | - | 996 | WP_126195939.1 | EamA family transporter | - |
ELY19_RS09310 | 1857556..1858446 | + | 891 | WP_126195940.1 | LysR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14196.89 Da Isoelectric Point: 4.3553
>T286502 WP_164711568.1 NZ_LR131273:c1853186-1852788 [Tsukamurella paurometabola]
MDTSALTKLIIAEQESDALTVWVAEQAEAHETLTTSDVGRIELMRTAARRDDDEIFDHARYVANWINGASVTEEIVAGAE
HIGPPSLRSLDAIHLASAVSIRELVSAFVSYDKRLLDAARAEGLPVVSPGAA
MDTSALTKLIIAEQESDALTVWVAEQAEAHETLTTSDVGRIELMRTAARRDDDEIFDHARYVANWINGASVTEEIVAGAE
HIGPPSLRSLDAIHLASAVSIRELVSAFVSYDKRLLDAARAEGLPVVSPGAA
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|