Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 704337..704988 | Replicon | chromosome |
| Accession | NZ_LR131273 | ||
| Organism | Tsukamurella paurometabola strain NCTC10741 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | ELY19_RS03640 | Protein ID | WP_164711501.1 |
| Coordinates | 704560..704988 (+) | Length | 143 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | ELY19_RS03635 | Protein ID | WP_126194987.1 |
| Coordinates | 704337..704567 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ELY19_RS03610 | 699778..700881 | + | 1104 | WP_126194982.1 | citrate synthase 2 | - |
| ELY19_RS03615 | 700885..702009 | + | 1125 | WP_126194983.1 | phosphoserine transaminase | - |
| ELY19_RS03620 | 702035..702820 | + | 786 | WP_126194984.1 | DUF3071 domain-containing protein | - |
| ELY19_RS03625 | 702825..703577 | + | 753 | WP_126194985.1 | hypothetical protein | - |
| ELY19_RS03630 | 703593..704246 | + | 654 | WP_126194986.1 | hypothetical protein | - |
| ELY19_RS03635 | 704337..704567 | + | 231 | WP_126194987.1 | hypothetical protein | Antitoxin |
| ELY19_RS03640 | 704560..704988 | + | 429 | WP_164711501.1 | PIN domain-containing protein | Toxin |
| ELY19_RS03645 | 705297..706580 | - | 1284 | WP_126194989.1 | MFS transporter | - |
| ELY19_RS03650 | 706617..706895 | - | 279 | WP_126194990.1 | DUF2537 domain-containing protein | - |
| ELY19_RS03655 | 706892..707692 | - | 801 | WP_126194991.1 | RNA methyltransferase | - |
| ELY19_RS03660 | 707723..708874 | + | 1152 | WP_126194992.1 | GNAT family N-acetyltransferase | - |
| ELY19_RS03665 | 708974..709429 | - | 456 | WP_126194993.1 | MarR family transcriptional regulator | - |
| ELY19_RS03670 | 709531..709740 | + | 210 | WP_126194994.1 | DUF2530 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15215.55 Da Isoelectric Point: 6.4869
>T286501 WP_164711501.1 NZ_LR131273:704560-704988 [Tsukamurella paurometabola]
MSDVELPDVNVLVALLSANHVHHTTARDWFASTPRFATTPITEAGLVRMALNRAVMGTAITAQQALASLASLRADDRAEF
VPDESSLAAPSIDLVGLAGHKQVTDLHLVNLMARHSGVLVTLDTRIRPVLTPADQPLVRVLL
MSDVELPDVNVLVALLSANHVHHTTARDWFASTPRFATTPITEAGLVRMALNRAVMGTAITAQQALASLASLRADDRAEF
VPDESSLAAPSIDLVGLAGHKQVTDLHLVNLMARHSGVLVTLDTRIRPVLTPADQPLVRVLL
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|