Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 2115098..2115579 Replicon chromosome
Accession NZ_LR130778
Organism Petrocella atlantisensis isolate 70B-A

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag PATL70BA_RS09855 Protein ID WP_125137197.1
Coordinates 2115313..2115579 (+) Length 89 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag PATL70BA_RS09850 Protein ID WP_125137196.1
Coordinates 2115098..2115316 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PATL70BA_RS09825 2110828..2111127 + 300 WP_125137193.1 IS66 family insertion sequence element accessory protein TnpB -
PATL70BA_RS09830 2111420..2113030 + 1611 WP_125137194.1 IS66 family transposase -
PATL70BA_RS09835 2113304..2114415 + 1112 Protein_1923 ATP-dependent DNA helicase RecG -
PATL70BA_RS09845 2114642..2114866 + 225 WP_125137195.1 hypothetical protein -
PATL70BA_RS09850 2115098..2115316 + 219 WP_125137196.1 CopG family transcriptional regulator Antitoxin
PATL70BA_RS09855 2115313..2115579 + 267 WP_125137197.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PATL70BA_RS09860 2115846..2116118 + 273 WP_125137198.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
PATL70BA_RS09865 2116111..2116368 + 258 WP_125137199.1 Txe/YoeB family addiction module toxin -
PATL70BA_RS09870 2116445..2117596 + 1152 Protein_1929 putative DNA binding domain-containing protein -
PATL70BA_RS09880 2117798..2118022 + 225 WP_125137200.1 hypothetical protein -
PATL70BA_RS09885 2118153..2118623 - 471 WP_125137201.1 transposase -
PATL70BA_RS09890 2118583..2118690 - 108 WP_125137202.1 transposase -
PATL70BA_RS09895 2118815..2119666 + 852 WP_125137203.1 HipA domain-containing protein -
PATL70BA_RS09900 2119663..2120493 + 831 WP_125137204.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-87)

Antitoxin

Protein of unknown function DUF6290

(1-70)


Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10515.46 Da        Isoelectric Point: 10.1201

>T286500 WP_125137197.1 NZ_LR130778:2115313-2115579 [Petrocella atlantisensis]
MKYKVEYTKTAVKQFKKMDKKIATFIIAYIEEKLVGCSDPRLYGKALQGNLRDKWRYRVGEYRILAKIEDEKILITIIEL
GHRKDIYQ

Download         Length: 267 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8643.79 Da        Isoelectric Point: 4.8053

>AT286500 WP_125137196.1 NZ_LR130778:2115098-2115316 [Petrocella atlantisensis]
MSTISIRLNDKDDTLIRKYAQLHQMDLSSFIRQAVIEKIEDEYDLTLFNKVWEEERYQDRISHDDLKKALGL

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References