Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 3014824..3015608 | Replicon | chromosome |
Accession | NZ_LR130564 | ||
Organism | Escherichia coli strain MS14387 isolate MS14387 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | V0T0H9 |
Locus tag | FVE81_RS14775 | Protein ID | WP_000613626.1 |
Coordinates | 3015114..3015608 (+) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | L4JCW6 |
Locus tag | FVE81_RS14770 | Protein ID | WP_001110447.1 |
Coordinates | 3014824..3015117 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FVE81_RS14760 | 3009974..3010933 | - | 960 | WP_000846342.1 | 23S rRNA pseudouridine(955/2504/2580) synthase RluC | - |
FVE81_RS14765 | 3011506..3014691 | + | 3186 | WP_000827427.1 | ribonuclease E | - |
FVE81_RS14770 | 3014824..3015117 | + | 294 | WP_001110447.1 | DUF1778 domain-containing protein | Antitoxin |
FVE81_RS14775 | 3015114..3015608 | + | 495 | WP_000613626.1 | GNAT family N-acetyltransferase | Toxin |
FVE81_RS14780 | 3015703..3016656 | - | 954 | WP_001212768.1 | flagellar hook-associated protein FlgL | - |
FVE81_RS14785 | 3016668..3018311 | - | 1644 | WP_000096524.1 | flagellar hook-associated protein FlgK | - |
FVE81_RS14790 | 3018377..3019318 | - | 942 | WP_001309406.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
FVE81_RS14795 | 3019318..3020415 | - | 1098 | WP_000589320.1 | flagellar basal body P-ring protein FlgI | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 18084.00 Da Isoelectric Point: 8.2617
>T286488 WP_000613626.1 NZ_LR130564:3015114-3015608 [Escherichia coli]
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|