Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2618683..2619321 | Replicon | chromosome |
| Accession | NZ_LR130564 | ||
| Organism | Escherichia coli strain MS14387 isolate MS14387 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | B7N4J4 |
| Locus tag | FVE81_RS12595 | Protein ID | WP_000813797.1 |
| Coordinates | 2619145..2619321 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | FVE81_RS12590 | Protein ID | WP_076611057.1 |
| Coordinates | 2618683..2619099 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FVE81_RS12570 | 2613835..2614776 | - | 942 | WP_001251335.1 | ABC transporter permease | - |
| FVE81_RS12575 | 2614777..2615790 | - | 1014 | WP_000220413.1 | ABC transporter ATP-binding protein | - |
| FVE81_RS12580 | 2615808..2616953 | - | 1146 | WP_000047447.1 | ABC transporter substrate-binding protein | - |
| FVE81_RS12585 | 2617198..2618604 | - | 1407 | WP_000760613.1 | PLP-dependent aminotransferase family protein | - |
| FVE81_RS12590 | 2618683..2619099 | - | 417 | WP_076611057.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| FVE81_RS12595 | 2619145..2619321 | - | 177 | WP_000813797.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| FVE81_RS12600 | 2619543..2619773 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| FVE81_RS12605 | 2619865..2621826 | - | 1962 | WP_001309488.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| FVE81_RS12610 | 2621899..2622435 | - | 537 | WP_000429161.1 | DNA-binding transcriptional regulator SutR | - |
| FVE81_RS12615 | 2622488..2623699 | + | 1212 | WP_001323162.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6724.76 Da Isoelectric Point: 11.5666
>T286487 WP_000813797.1 NZ_LR130564:c2619321-2619145 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPSDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPSDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15251.65 Da Isoelectric Point: 4.5908
>AT286487 WP_076611057.1 NZ_LR130564:c2619099-2618683 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLTNNDHFIEVPLSIASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLTNNDHFIEVPLSIASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|