Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 801021..801822 | Replicon | chromosome |
| Accession | NZ_LR130564 | ||
| Organism | Escherichia coli strain MS14387 isolate MS14387 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | U9ZA48 |
| Locus tag | FVE81_RS03870 | Protein ID | WP_001513431.1 |
| Coordinates | 801021..801398 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | U9YYT7 |
| Locus tag | FVE81_RS03875 | Protein ID | WP_001513429.1 |
| Coordinates | 801445..801822 (-) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FVE81_RS03845 | 797153..798136 | - | 984 | WP_001329577.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
| FVE81_RS03850 | 798946..799116 | - | 171 | Protein_755 | IS110 family transposase | - |
| FVE81_RS03855 | 799459..800301 | - | 843 | WP_001513432.1 | DUF4942 domain-containing protein | - |
| FVE81_RS03860 | 800386..800583 | - | 198 | WP_001374283.1 | DUF957 domain-containing protein | - |
| FVE81_RS03865 | 800595..801024 | - | 430 | Protein_758 | hypothetical protein | - |
| FVE81_RS03870 | 801021..801398 | - | 378 | WP_001513431.1 | TA system toxin CbtA family protein | Toxin |
| FVE81_RS03875 | 801445..801822 | - | 378 | WP_001513429.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| FVE81_RS03880 | 801985..802206 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| FVE81_RS03885 | 802275..802751 | - | 477 | WP_001186726.1 | RadC family protein | - |
| FVE81_RS03890 | 802767..803252 | - | 486 | WP_001513428.1 | antirestriction protein | - |
| FVE81_RS03895 | 803307..804125 | - | 819 | WP_001513427.1 | DUF945 domain-containing protein | - |
| FVE81_RS25955 | 804206..804417 | + | 212 | Protein_765 | hypothetical protein | - |
| FVE81_RS03910 | 804536..804991 | - | 456 | WP_000581502.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 801021..832000 | 30979 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13941.80 Da Isoelectric Point: 7.3225
>T286479 WP_001513431.1 NZ_LR130564:c801398-801021 [Escherichia coli]
MNTLPDTHVREASGCPSPITIRQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHPEAKQ
MNTLPDTHVREASGCPSPITIRQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13688.48 Da Isoelectric Point: 5.9505
>AT286479 WP_001513429.1 NZ_LR130564:c801822-801445 [Escherichia coli]
VSDTLPGTTPPDDNHDRPWWGLPCTVTSCFGARLVQEGNRLHYLADRAGIRGRFSDVDAYHLDQAFPLLMKQLELMLTGG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAAPATTV
VSDTLPGTTPPDDNHDRPWWGLPCTVTSCFGARLVQEGNRLHYLADRAGIRGRFSDVDAYHLDQAFPLLMKQLELMLTGG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAAPATTV
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|