Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
| Location | 4312281..4313101 | Replicon | chromosome |
| Accession | NZ_LR130562 | ||
| Organism | Escherichia coli strain MS14384 isolate MS14384 | ||
Toxin (Protein)
| Gene name | yjhX | Uniprot ID | S1PA82 |
| Locus tag | EW037_RS20840 | Protein ID | WP_001054376.1 |
| Coordinates | 4312281..4312538 (+) | Length | 86 a.a. |
Antitoxin (Protein)
| Gene name | yjhQ | Uniprot ID | - |
| Locus tag | EW037_RS20845 | Protein ID | WP_000215866.1 |
| Coordinates | 4312550..4313101 (+) | Length | 184 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW037_RS20820 | 4307567..4308673 | + | 1107 | WP_001044124.1 | N-acetylneuraminate epimerase | - |
| EW037_RS20825 | 4308738..4309718 | + | 981 | WP_001765419.1 | sialate O-acetylesterase | - |
| EW037_RS20830 | 4310301..4311527 | - | 1227 | Protein_4007 | helicase YjhR | - |
| EW037_RS20835 | 4311605..4311904 | + | 300 | WP_024186563.1 | GNAT family N-acetyltransferase | - |
| EW037_RS20840 | 4312281..4312538 | + | 258 | WP_001054376.1 | hypothetical protein | Toxin |
| EW037_RS20845 | 4312550..4313101 | + | 552 | WP_000215866.1 | N-acetyltransferase | Antitoxin |
| EW037_RS20850 | 4313153..4313899 | + | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
| EW037_RS20855 | 4314026..4314286 | + | 261 | WP_000084876.1 | hypothetical protein | - |
| EW037_RS25615 | 4314324..4314440 | + | 117 | Protein_4013 | VOC family protein | - |
| EW037_RS20860 | 4314685..4315806 | + | 1122 | WP_000010835.1 | M42 family metallopeptidase | - |
| EW037_RS20865 | 4315803..4316081 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB | - |
| EW037_RS20870 | 4316093..4317406 | + | 1314 | WP_000460846.1 | galactitol-specific PTS transporter subunit IIC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fimC / fimI / fimA / fimE / fimB | 4301309..4321321 | 20012 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T286470 WP_001054376.1 NZ_LR130562:4312281-4312538 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 184 a.a. Molecular weight: 20493.64 Da Isoelectric Point: 6.8758
>AT286470 WP_000215866.1 NZ_LR130562:4312550-4313101 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKETDLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCAQALMKPEHWRE
MTVHHFTFHITDKSDASDIREVETRAFGFSKETDLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCAQALMKPEHWRE
Download Length: 552 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|