286468

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4137773..4138197 Replicon chromosome
Accession NZ_LR130562
Organism Escherichia coli strain MS14384 isolate MS14384

Toxin (Protein)


Gene name ccdB Uniprot ID -
Locus tag EW037_RS25520 Protein ID WP_001586653.1
Coordinates 4137773..4137961 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag EW037_RS20005 Protein ID WP_000125566.1
Coordinates 4137964..4138197 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EW037_RS19975 4133335..4134621 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
EW037_RS19980 4134621..4135610 + 990 WP_000241280.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
EW037_RS19985 4135607..4136428 + 822 WP_001065361.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
EW037_RS19990 4136431..4136808 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
EW037_RS19995 4136815..4137663 + 849 WP_000257195.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
EW037_RS25515 4137660..4137776 - 117 WP_001389634.1 CcdB family protein -
EW037_RS25520 4137773..4137961 - 189 WP_001586653.1 CcdB family protein Toxin
EW037_RS20005 4137964..4138197 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
EW037_RS20010 4138283..4138762 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
EW037_RS20015 4138954..4140816 - 1863 WP_000377117.1 glutathione-regulated potassium-efflux system protein KefC -
EW037_RS20020 4140809..4141339 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
EW037_RS20025 4141447..4142778 - 1332 WP_001183198.1 MFS transporter -
EW037_RS20030 4142837..4143124 - 288 WP_001596509.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-57)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7029.22 Da        Isoelectric Point: 8.7938

>T286468 WP_001586653.1 NZ_LR130562:c4137961-4137773 [Escherichia coli]
MQFTVYRSRGSNAAFPFVIDVTSDIIGEINRSIVIPLTPIERFIRIRPPERLNTILLLVDGS

Download         Length: 189 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT286468 WP_000125566.1 NZ_LR130562:c4138197-4137964 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References