Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2647658..2648296 | Replicon | chromosome |
Accession | NZ_LR130562 | ||
Organism | Escherichia coli strain MS14384 isolate MS14384 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | EW037_RS12935 | Protein ID | WP_000813794.1 |
Coordinates | 2648120..2648296 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | EW037_RS12930 | Protein ID | WP_001270286.1 |
Coordinates | 2647658..2648074 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EW037_RS12910 | 2642810..2643751 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
EW037_RS12915 | 2643752..2644765 | - | 1014 | WP_001595723.1 | ABC transporter ATP-binding protein | - |
EW037_RS12920 | 2644783..2645928 | - | 1146 | WP_000047452.1 | ABC transporter substrate-binding protein | - |
EW037_RS12925 | 2646173..2647579 | - | 1407 | WP_001595721.1 | PLP-dependent aminotransferase family protein | - |
EW037_RS12930 | 2647658..2648074 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
EW037_RS12935 | 2648120..2648296 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
EW037_RS12940 | 2648518..2648748 | + | 231 | WP_000494241.1 | YncJ family protein | - |
EW037_RS12945 | 2648840..2650801 | - | 1962 | WP_001595719.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
EW037_RS12950 | 2650874..2651410 | - | 537 | WP_001595717.1 | DNA-binding transcriptional regulator SutR | - |
EW037_RS12955 | 2651463..2652674 | + | 1212 | WP_071600865.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T286462 WP_000813794.1 NZ_LR130562:c2648296-2648120 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT286462 WP_001270286.1 NZ_LR130562:c2648074-2647658 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|